Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
PGK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been confirmed through extensive research using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its efficacy in inhibiting cell growth. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranosCarboxylesterase 2 antibody
Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEGSOX6 antibody
SOX6 antibody is a hormone peptide that is used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies. This antibody is specifically designed to target SOX6, a nuclear protein involved in the regulation of gene expression. It can be used for various applications, including immunoassays, western blotting, immunohistochemistry, and more.RELA antibody
RELA antibody is a monoclonal antibody that specifically targets the protein RELA, also known as p65. RELA is a subunit of the transcription factor NF-κB, which plays a critical role in regulating immune responses and inflammation. This antibody binds to RELA and inhibits its activity, thereby modulating the expression of genes involved in various cellular processes.Luteinizing Hormone antibody
Luteinizing Hormone antibody is a monoclonal antibody that targets and binds to luteinizing hormone (LH) in the human body. LH is a hormone produced by the pituitary gland that plays a crucial role in reproductive health and fertility. This antibody has been extensively studied in Life Sciences and has shown promising results in various applications.EDG4 antibody
The EDG4 antibody is a glycoprotein that specifically targets the glutamate receptor and IL-1 receptor. It belongs to the class of polyclonal antibodies and has neutralizing properties against interleukin. This antibody is widely used in life sciences research for various applications, including the detection and quantification of specific proteins and biomarkers.TOP2A antibody
The TOP2A antibody is a highly specific monoclonal antibody that is used in various applications in the field of Life Sciences. It is designed to specifically target and bind to the TOP2A protein, which plays a crucial role in DNA replication and repair processes. This antibody can be used for various purposes, including research, diagnostics, and therapeutic applications.PPME1 antibody
PPME1 antibody was raised using the N terminal of PPME1 corresponding to a region with amino acids PGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGIRF4 antibody
The IRF4 antibody is a highly specialized antibody used in various assays and experiments within the field of Life Sciences. It can be obtained as either polyclonal antibodies or monoclonal antibodies, depending on the specific requirements of the experiment. This antibody targets the EGF-like domain of IRF4, which is an important protein involved in regulating gene expression and immune response. The IRF4 antibody can be used for a variety of applications, including Western blotting, immunohistochemistry, and flow cytometry. It has also been shown to have neutralizing properties against certain proteins, such as sclerostin and cystatin. Additionally, this antibody has been used in studies involving glucose-6-phosphate inhibitors and ornithine activation. With its high specificity and effectiveness, the IRF4 antibody is an invaluable tool for researchers in the Life Sciences field.ASK1 antibody
The ASK1 antibody is a powerful medicinal composition that acts as an inhibitor of the signal-regulating kinase known as ASK1. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent for various diseases. By inhibiting the activity of ASK1, this antibody blocks intracellular ATP and reduces pro-inflammatory activity, making it a valuable tool in the development of anti-inflammatory drugs. Additionally, the ASK1 antibody has been used in assays to study integrin binding and its role in cell signaling pathways. With its versatility and potential applications, this polyclonal antibody holds great promise as a research tool and may even have future implications in the development of anticancer agents.
Procalcitonin antibody
Procalcitonin antibody is a highly specialized monoclonal antibody that has multiple applications in the field of life sciences. This antibody is known for its ability to undergo endocytic uptake and exhibit antiangiogenic activity. It can be used in various research studies involving the detection and quantification of procalcitonin levels.NF kappaB p65 antibody
The NF kappaB p65 antibody is a highly specialized monoclonal antibody that is designed to specifically target and neutralize the nuclear factor kappaB (NF-kappaB) p65 protein. This protein is known to play a crucial role in regulating gene expression and inflammatory responses in various cells and tissues.EGF antibody
EGF antibody was raised in Mouse using a purified recombinant fragment of human EGF expressed in E. coli as the immunogen.PIAS2 antibody
The PIAS2 antibody is a serum marker protein that is used in the field of Life Sciences. It belongs to the class of Antibodies and is specifically designed to detect and bind to PIAS2, a protein involved in various cellular processes. This polyclonal antibody is highly specific and can be used for research purposes as well as therapeutically. With its ability to target PIAS2, this antibody provides valuable insights into the functioning of cells and can aid in the development of novel treatments and therapies. Whether you are conducting experiments or looking for potential therapeutic options, the PIAS2 antibody is an essential tool in your arsenal.BID antibody
The BID antibody is a polyclonal antibody that is capable of neutralizing the antigen. It specifically targets membrane-spanning polypeptides, forming dimers and effectively neutralizing their activity. This synthetic antibody has been extensively tested and shown to effectively bind to activated amyloid plaque, making it a valuable tool in life sciences research. The BID antibody is commonly used in buffered assays and can also be used in combination with other monoclonal antibodies for enhanced specificity and sensitivity. Its high-quality formulation ensures reliable and reproducible results in various experimental applications.Borrelia burgdorferi antibody (HRP)
Borrelia burgdorferi antibody (HRP) was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.C20ORF141 antibody
C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLLIL1A antibody
IL1A antibody is a monoclonal antibody that specifically targets interleukin-1 alpha (IL-1α), a cytokine involved in various inflammatory processes. IL-1α plays a crucial role in the regulation of immune responses and is associated with several diseases, including autoimmune disorders and cancer. This antibody binds to IL-1α, preventing its interaction with its receptors and blocking downstream signaling pathways. It has been shown to inhibit the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, IL1A antibody has demonstrated efficacy in multidrug-resistant cancer cell lines, suggesting its potential as a therapeutic agent. Its high affinity for IL-1α ensures effective neutralization of this cytokine, making it an essential tool for researchers in the field of life sciences.PABPC4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. This active compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.CHIA antibody
CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
Degré de pureté :Min. 95%Ankyrin antibody
Ankyrin antibody was raised in mouse using purified human erythroid cells ankyrin as the immunogen.HIV1 gp120 antibody (HRP)
HIV1 gp120 antibody (HRP) was raised in goat using purified native gp120 from strain IIIB as the immunogen.GSTZ1 antibody
GSTZ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFMBNL1 antibody
MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISARAI14 antibody
RAI14 antibody was raised using the middle region of RAI14 corresponding to a region with amino acids ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAEZADH2 antibody
ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVTHINT1 antibody
HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADRELT antibody
The RELT antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that has been specifically developed to target and neutralize the activity of hepcidin, a growth factor involved in various physiological processes. This antibody has been extensively tested and proven to effectively inhibit hepcidin-induced syncytia formation.
FZD5 antibody
The FZD5 antibody is a monoclonal antibody that targets the frizzled-5 receptor, a member of the frizzled family of proteins. This receptor plays a crucial role in the Wnt signaling pathway, which is involved in various cellular processes such as cell proliferation, differentiation, and migration. The FZD5 antibody specifically binds to the activated form of the frizzled-5 receptor, blocking its interaction with Wnt ligands and preventing downstream signaling events.STEAP4 antibody
The STEAP4 antibody is a polyclonal antibody that targets the STEAP4 protein. This protein plays a crucial role in various biological processes, including interleukin-6 signaling, protein phosphatase activity, fibrinogen metabolism, actin filament organization, and cytotoxicity. The STEAP4 antibody is widely used in life sciences research to study the function and regulation of this important protein.MGST2 antibody
MGST2 antibody was raised using the N terminal of MGST2 corresponding to a region with amino acids MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFCCL24 antibody
The CCL24 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and neutralizes chemokine CCL24, a protein involved in various inflammatory processes. This antibody can be used as a cross-linking agent to study the interactions between CCL24 and other molecules, such as globulins or colloidal particles. It is commonly used in assays to detect and quantify CCL24 levels in biological samples.
proBNP antibody
The proBNP antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to proBNP, which is a precursor to the hormone B-type natriuretic peptide (BNP). This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs.
p16 antibody
p16 antibody was raised in Mouse using a purified recombinant fragment of p16 expressed in E. coli as the immunogen.CLCNKB antibody
CLCNKB antibody was raised using the N terminal of CLCNKB corresponding to a region with amino acids MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDWDUSP6 antibody
The DUSP6 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to glial fibrillary acidic protein (GFAP), a protein found in the central nervous system. This antibody has been extensively used in research to study the role of GFAP in various cellular processes.Cytokeratin 7 antibody
Cytokeratin 7 antibody was raised in Mouse using a purified recombinant fragment of human CK7 expressed in E. coli as the immunogen.ABL1 antibody
The ABL1 antibody is a powerful tool used in the field of Life Sciences for various applications. It is an antibody specifically designed to target and bind to the ABL1 protein, which plays a crucial role in cell signaling and regulation. This antibody can be used for research purposes, such as studying the function of ABL1 in different cellular processes or investigating its involvement in diseases like cancer.TNFRSF14 antibody
TNFRSF14 antibody was raised in rabbit using the middle region of TNFRSF14 as the immunogenGluR4 antibody
The GluR4 antibody is a highly specialized antibody used in Life Sciences research. It is commonly used in studies involving glutamate receptors and their role in various biological processes. This antibody specifically targets the GluR4 subunit, which is known to be involved in neuronal excitability and synaptic plasticity.CD62L antibody
CD62L antibody was raised in rat using C3H/eb cloned murine B lymphoma 38C-13 as the immunogen.ARHGAP19 antibody
ARHGAP19 antibody was raised in rabbit using the C terminal of ARHGAP19 as the immunogenHSP70 antibody
The HSP70 antibody is a polyclonal antibody that specifically binds to heat shock protein 70 (HSP70). Heat shock proteins are a group of proteins that are produced in response to stress, such as high temperatures or exposure to toxins. HSP70 is involved in various cellular processes, including protein folding, transport, and degradation.14-3-3 sigma antibody
The 14-3-3 sigma antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets the 14-3-3 sigma protein, which plays a crucial role in various cellular processes. This antibody can be used to detect and quantify the expression levels of 14-3-3 sigma in different samples, such as cell lysates or tissue extracts.Fibrin Fragment E antibody (HRP)
Fibrin Fragment E antibody (HRP) was raised in sheep using human Fibrin Fragment E purified from plasma lysate of crosslinked fibrin clot as the immunogen.
C11ORF46 antibody
C11ORF46 antibody was raised using the N terminal Of C11Orf46 corresponding to a region with amino acids SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK
