Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
BIVM antibody
BIVM antibody was raised using the middle region of BIVM corresponding to a region with amino acids PFGTIRQESQPPTHAQGIAKSESEDNISKKQHGRLGRSFSASFHQDSAWKMERTK Antibody
The MERTK Antibody is a highly specialized monoclonal antibody that targets the MERTK protein. This activated anti-MERTK antibody has been extensively researched and developed in the field of Life Sciences. It is specifically designed to neutralize the activity of MERTK, an important receptor tyrosine kinase involved in various cellular processes.
GLUT2 antibody
GLUT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDegré de pureté :Min. 95%OGDHL antibody
The OGDHL antibody is an essential tool in the field of Life Sciences. It is an antigen that specifically targets OGDHL, a key enzyme involved in various cellular processes. This antibody can be used for research purposes such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA).
PRDX6 antibody
PRDX6 antibody was raised using the middle region of PRDX6 corresponding to a region with amino acids ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDPPBP antibody
The PPBP antibody is a highly specialized antibody that has cytotoxic effects on HER2-positive cells. It specifically targets the HER2 receptor, which is overexpressed in certain types of cancer cells. The PPBP antibody, also known as trastuzumab, is a monoclonal antibody that binds to the HER2 receptor and prevents its activation by growth factors. This inhibition leads to a decrease in cell proliferation and an increase in cell death.FAM98B antibody
FAM98B antibody was raised using the N terminal of FAM98B corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEIJunB antibody
The JunB antibody is a specific antibody that is commonly used in Life Sciences research. It is a mouse monoclonal antibody that specifically targets the JunB protein, which plays a crucial role in the regulation of pluripotent stem cells. This antibody can be used to detect and quantify JunB protein levels in various biological samples, including human serum and isolated nucleic acids.CD152 antibody (Azide Free)
CD152 antibody was raised in hamster using keat-killed Staphylococcus A bacteria coated with murine CTLA-4/human IgG1 fusion protein as the immunogen.FAM83F antibody
FAM83F antibody was raised using the N terminal of FAM83F corresponding to a region with amino acids KDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQDIVDAACKRRVPVLSM14A antibody
LSM14A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNICytokeratin 18 antibody
Cytokeratin 18 antibody was raised using the N terminal of KRT18 corresponding to a region with amino acids TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF
F7 antibody
F7 antibody was raised in rabbit using the middle region of F7 as the immunogen
Degré de pureté :Min. 95%BCL2 antibody
The BCL2 antibody is a highly specialized product designed for various assays and experiments in the field of Life Sciences. This polyclonal antibody is specifically designed to target the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell death and survival. With its high viscosity, this antibody is particularly effective in extracting nuclear proteins and identifying their interactions with other molecules.C14ORF148 antibody
C14ORF148 antibody was raised using the middle region of C14Orf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAGEP300 antibody
EP300 antibody was raised in Mouse using a purified recombinant fragment of EP300 expressed in E. coli as the immunogen.P38 MAPK antibody
The P38 MAPK antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target the activated form of p38 mitogen-activated protein kinase (MAPK). This antibody has been extensively tested and validated for its specificity and sensitivity in detecting p38 MAPK in various biological samples.MDM2 antibody
The MDM2 antibody is a highly specialized antibody that targets the mitogen-activated protein (MAP) pathway. It has cytotoxic properties and can effectively inhibit cell growth and proliferation. This antibody is commonly used in Life Sciences research to study various cellular processes, including the interaction of fibronectin and collagen, as well as the role of estrogen receptors.Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a highly effective tool used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, making it suitable for various applications. This antibody specifically targets the estrogen receptor alpha, an important antigen involved in hormone signaling pathways.CER1 antibody
CER1 antibody was raised in Mouse using a purified recombinant fragment of human CER1 expressed in E. coli as the immunogen.SFRP5 antibody
SFRP5 antibody was raised in rabbit using residues 25-38 [APARCEEYDYYGWQ] of human SFRP5 as the immunogen.Degré de pureté :Min. 95%Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a monoclonal antibody that specifically targets the estrogen receptor alpha (ERα). This antibody is widely used in research and diagnostic applications to study the role of ERα in various biological processes. It has been shown to be effective in detecting and quantifying ERα levels in tissues and cells.
MAGEL2 antibody
MAGEL2 antibody was raised in rabbit using the C terminal of MAGEL2 as the immunogenDegré de pureté :Min. 95%PLSCR1 antibody
PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
Protein C antibody
Protein C antibody was raised in sheep using human Protein C purified from plasma as the immunogen.p53 antibody
The p53 antibody is a protein that specifically targets and binds to the p53 protein, which plays a crucial role in cell cycle regulation and tumor suppression. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.
PRSS8 antibody
PRSS8 antibody was raised using the middle region of PRSS8 corresponding to a region with amino acids PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLERSBN1 antibody
RSBN1 antibody was raised using the N terminal of RSBN1 corresponding to a region with amino acids EGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQ
CES2 antibody
The CES2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the CES2 protein, which is a growth factor involved in various cellular processes. This antibody has been extensively studied and validated for its high specificity and affinity towards CES2.IL22R alpha 1 antibody
IL22R alpha 1 antibody was raised using the middle region of IL22RA1 corresponding to a region with amino acids DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWEDegré de pureté :Min. 95%Oncostatin M antibody
The Oncostatin M antibody is a polyclonal antibody that specifically targets and neutralizes oncostatin M (OSM), a cytokine involved in various biological processes. This antibody is widely used in life sciences research to study the role of OSM in different cellular pathways and disease conditions.MCM5 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the rifamycins class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
IL5 antibody
IL5 antibody was raised in rabbit using highly pure recombinant human IL-5 as the immunogen.ASL antibody
ASL antibody was raised using the middle region of ASL corresponding to a region with amino acids LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDKCD10 antibody
CD10 antibody was raised in Mouse using a purified recombinant fragment of CD10 expressed in E. coli as the immunogen.Nucleobindin 2 antibody
Nucleobindin 2 antibody was raised using the C terminal of NUCB2 corresponding to a region with amino acids FFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHPPP4R2 antibody
PPP4R2 antibody was raised using the C terminal of PPP4R2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNECHIA antibody
CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL
Degré de pureté :Min. 95%ZKSCAN1 antibody
ZKSCAN1 antibody was raised in rabbit using the middle region of ZKSCAN1 as the immunogen
Degré de pureté :Min. 95%ApoH antibody
ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADDegré de pureté :Min. 95%SENP1 antibody
SENP1 antibody was raised using the middle region of SENP1 corresponding to a region with amino acids PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLLSGLT2 antibody
The SGLT2 antibody is a highly specialized monoclonal antibody that acts as an inhibitor of the sodium-glucose cotransporter 2 (SGLT2). It is designed to target and neutralize the activity of SGLT2, which plays a key role in glucose reabsorption in the kidneys. By inhibiting SGLT2, this antibody helps to reduce blood glucose levels by increasing urinary glucose excretion.NAP1L2 antibody
NAP1L2 antibody was raised using the middle region of NAP1L2 corresponding to a region with amino acids VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNEHSP90B1 antibody
HSP90B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDLIMK1 antibody
The LIMK1 antibody is a highly specialized insulin antibody that is used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and bind to activated LIMK1 protein. This antibody has been extensively tested and validated for its specificity and sensitivity.LRRC3 antibody
LRRC3 antibody was raised using the middle region of LRRC3 corresponding to a region with amino acids TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEARPS14 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections by targeting and inhibiting bacterial growth. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication within bacteria. In addition, it has been extensively studied using advanced techniques such as patch-clamp, which have confirmed its high efficacy in human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Moreover, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth. With its bactericidal activity and proven effectiveness, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a reliable choice for combating tuberculosis infections.
