Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
GFP antibody
GFP antibody was raised in mouse using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.HAT antibody
The HAT antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to collagen, a protein found in connective tissues. The HAT antibody can be used in various applications, including immunoassays and cytotoxicity studies. It has been shown to have neutralizing properties against trypsin-like protease, which plays a role in tissue lysis. Additionally, the HAT antibody has been found to inhibit reactive oxygen species production and lipid peroxidation, making it useful for studying oxidative stress-related processes. With its high specificity and affinity for collagen, this antibody is a valuable tool for researchers working in the field of cell biology and molecular biology.
USP7 antibody
The USP7 antibody is a monoclonal antibody that targets the USP7 protein. It has been shown to have a wide range of applications in the field of Life Sciences. This antibody specifically binds to USP7 and inhibits its activity, which plays a crucial role in various cellular processes including IFN-gamma signaling, fatty acid metabolism, siderophore production, and superoxide regulation.TRIM2 antibody
The TRIM2 antibody is a highly specialized monoclonal antibody that targets insulin and has neutralizing properties. It specifically binds to cholinergic receptors, inhibiting their activity and preventing the release of insulin. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.BRS3 antibody
The BRS3 antibody is a polyclonal antibody that serves as an affinity ligand for extracellular substances. It is commonly used in the field of medicine to isolate retinal autoantibodies. The BRS3 antibody has been found to be effective in inhibiting DNA double-strand break repair and can be used as a tool for studying the mechanisms involved in this process. In addition, it has been shown to inhibit the growth of pluripotent stem cells and can be used in research related to their differentiation. The BRS3 antibody is often employed in immunohistochemical studies to detect the presence of certain markers or proteins in tissue samples. Its use in life sciences research has provided valuable insights into various biological processes and pathways.UBE2L6 antibody
UBE2L6 antibody was raised in mouse using recombinant human UBE2L6 (1-152aa) purified from E. coli as the immunogen.
VEGFR3 antibody
The VEGFR3 antibody is a highly effective medicament that targets the glucan synthase and growth factor. It belongs to the class of Monoclonal Antibodies, which are known for their specificity and potency. This antibody specifically binds to epidermal growth factor (EGF) receptors on the apical membrane of cells, inhibiting their activation. By blocking the activity of EGF receptors, this monoclonal antibody prevents the binding of other cell antibodies and autoantibodies, thereby reducing inflammation and promoting healing. Additionally, studies have shown that the VEGFR3 antibody has antiviral properties and can help alleviate hepatic steatosis. With its wide range of applications in various pharmaceutical preparations, this antibody is an essential tool in modern medicine.BTAF1 antibody
BTAF1 antibody was raised in mouse using recombinant Btaf1 Rna Polymerase Ii, B-Tfiid Transcription Factor-Associated, 170Kda (Mot1 Homolog, S. Cerevisiae) (Btaf1)Caveolin 1 antibody
The Caveolin 1 antibody is a highly effective and versatile tool used in various fields of life sciences. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their specific needs.Cdc2 antibody
Cdc2 antibody was raised in Mouse using a purified recombinant fragment of Cdc2 expressed in E. coli as the immunogen.BRAF antibody
The BRAF antibody is a powerful tool used in Life Sciences research for the detection and analysis of specific proteins. This monoclonal antibody specifically targets the BRAF protein, which plays a crucial role in cell signaling pathways and is frequently mutated in various cancers. By binding to BRAF, this antibody allows researchers to study its expression, localization, and interactions with other molecules.PIP4K2A antibody
PIP4K2A antibody was raised using the middle region of PIP4K2A corresponding to a region with amino acids EQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDPPA2 antibody
The DPPA2 antibody is a monoclonal antibody that targets and neutralizes the growth factor DPPA2. It has been shown to inhibit caspase-9 activity, which plays a crucial role in apoptosis. This antibody is formulated with excipients such as histidine and colloidal globulin to enhance stability and efficacy. It can be used in various applications in Life Sciences, including research on mesenchymal stem cells and alpha-fetoprotein. The DPPA2 antibody is a highly specific and potent tool for studying the function of DPPA2 and its role in cellular processes.FSHR antibody
The FSHR antibody is a neutralizing antibody that targets the follicle-stimulating hormone receptor (FSHR). It specifically binds to estrogen receptors and inhibits their activity. This antibody is commonly used in Life Sciences research to study hormone peptides, glycans, and tyrosine residues. It is available as both a monoclonal antibody and a polyclonal antibody.BSG antibody
The BSG antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is designed to bind to the glycan moiety of TNF-α, preventing its interaction with cell surface receptors. This antibody can be used in various research applications, such as immunohistochemistry and flow cytometry, to detect and quantify TNF-α levels. The BSG antibody has been extensively validated and shown to have high specificity and affinity for TNF-α. Its neutralizing properties make it a valuable tool for studying the role of TNF-α in various physiological and pathological processes. Additionally, this antibody has been used in therapeutic settings, such as the treatment of inflammatory diseases like rheumatoid arthritis, where excessive TNF-α production plays a key role in disease progression.PHACTR3 antibody
PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQRBRAF antibody
The BRAF antibody is a highly specialized and reactive antibody that targets the activated form of the BRAF protein. This protein is involved in cell growth and plays a crucial role in various biological processes. The BRAF antibody is cytotoxic, meaning it has the ability to kill cells that express high levels of the activated BRAF protein.Aquaporin 7 antibody
Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMAVaspin antibody
Vaspin antibody was raised in mouse using recombinant human Vaspin (21-414aa) purified from E. coli as the immunogen.Nuclear Pore Complex antibody
The Nuclear Pore Complex antibody is a highly specific monoclonal antibody designed for use in Life Sciences research. It is used to detect and study the nuclear pore complex, a structure that regulates the transport of molecules between the nucleus and cytoplasm. This antibody binds specifically to proteins within the nuclear pore complex, allowing researchers to visualize and study its function.TSTA3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth.
CD2 antibody
The CD2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It interacts with CD2, a cell surface glycoprotein expressed on T cells, natural killer cells, and thymocytes. This antibody has been extensively studied for its potential applications in various areas of research.
PLDN antibody
PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE
Tau antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains, leading to cell growth inhibition in culture.BAK antibody
The BAK antibody is a cytotoxic monoclonal antibody that targets specific proteins in the body. It has been shown to inhibit the activity of interleukin-6, fibronectin, and other growth factors. This antibody can be used in various research and diagnostic applications, including immunoassays and protein detection. It is commonly used in life sciences research, where it has been shown to have an impact on collagen synthesis, lipoprotein lipase activity, and retinoid metabolism. The BAK antibody is also used in the development of therapeutic drugs, such as adalimumab, and has been shown to promote hepatocyte growth. With its multidrug properties and wide range of applications, the BAK antibody is a valuable tool for researchers and scientists in various fields.BRI3 antibody
The BRI3 antibody is a powerful tool in the field of Life Sciences. It is a steroid derivative that belongs to the class of monoclonal antibodies. This antibody specifically targets a molecule of interest, making it an essential tool for researchers studying various biological processes. The BRI3 antibody can be used in a wide range of applications, including immunohistochemistry, Western blotting, and ELISA assays.HAL antibody
HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETSERPINE1 antibody
The SERPINE1 antibody is a highly specialized antibody that targets the glutamate receptor. It belongs to the class of polyclonal antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also inhibits the activity of colony-stimulating factors, which are important for immune response regulation. The SERPINE1 antibody has been shown to be reactive against various monoclonal antibodies, making it a versatile tool for research purposes. Additionally, it exhibits cytotoxic effects on pluripotent cells and can inhibit the activity of protein kinases, including oncogenic kinases. This monoclonal antibody is non-phosphorylated, ensuring its stability and effectiveness in experimental settings. With its wide range of applications in molecular biology and immunology research, the SERPINE1 antibody is an invaluable tool for scientists seeking to unravel complex cellular mechanisms.Keratin 18 antibody
The Keratin 18 antibody is a nanocomposite that consists of a DNA aptamer with an amino group. It can be used in Life Sciences research to study the growth factor and protein kinases involved in various cellular processes. The antibody specifically targets Keratin 18, which is a protein expressed in epithelial cells. This monoclonal antibody allows for the detection and visualization of Keratin 18 through an antigen-antibody reaction. It can be used in applications such as immunofluorescence staining, western blotting, and polymerase chain reactions (PCR). The Keratin 18 antibody is highly specific and sensitive, making it a valuable tool for researchers studying cellular biology and disease mechanisms.
RPL37A antibody
RPL37A antibody was raised using the middle region of RPL37A corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKDNDUFA9 antibody
NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYnNOS antibody
The nNOS antibody is a highly effective tool in the field of atypical hemolytic research. It is specifically designed to target and detect brucella abortus, a bacterium that causes serious infections in animals and humans. This antibody belongs to the class of polyclonal antibodies, which means it can recognize multiple epitopes on the target protein.MCL1 antibody
The MCL1 antibody is a monoclonal antibody used in Life Sciences. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α), which is involved in inflammation and cell death. This antibody can also target molecules such as insulin and growth factors, making it a valuable tool in research and therapeutic applications. Additionally, the MCL1 antibody can be used to detect specific proteins, including rubisco, and can be utilized in various immunoassays. With its specificity and versatility, this monoclonal antibody is a valuable asset for scientists and researchers in the field of Life Sciences.
