Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
DTNB antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective treatment against tuberculosis infections.Vimentin antibody
Vimentin antibody was raised in mouse using vimentin purified from bovine lens as the immunogen.THYN1 antibody
THYN1 antibody was raised using the middle region of THYN1 corresponding to a region with amino acids NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKRPUSD2 antibody
RPUSD2 antibody was raised using the N terminal of RPUSD2 corresponding to a region with amino acids LKDNDFLRNTVHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHPCGRFRPSMA6 antibody
PSMA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENMAGEB1 antibody
MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS
ASS1 antibody
ASS1 antibody was raised using the C terminal Of Ass corresponding to a region with amino acids SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEACK1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. The effectiveness of this drug has been demonstrated through advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.CLEC4M antibody
CLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV
FUS2 antibody
FUS2 antibody was raised in mouse using recombinant FUS2 (1-308aa) purified from E. coli as the immunogen.IFN alpha antibody
The IFN alpha antibody is a diagnostic reagent used in the field of Life Sciences. It is a monoclonal antibody that specifically targets interferon alpha, a type of growth factor involved in immune responses. This antibody has been shown to neutralize the activity of interferon alpha, preventing its binding to receptors and subsequent signaling pathways. Additionally, the IFN alpha antibody has been found to enhance reactive oxygen species production and induce lysis in cells expressing interferon alpha. It also plays a role in iron homeostasis by binding to spleen ferritin, a metal-binding protein involved in iron storage and release. The IFN alpha antibody is widely used in research and clinical settings for studying the antiviral properties of interferon alpha and its potential therapeutic applications.PROZ antibody
PROZ antibody was raised in Mouse using a purified recombinant fragment of PROZ expressed in E. coli as the immunogen.
CD15 antibody
CD15 antibody is a monoclonal antibody that targets the CD15 antigen, also known as Lewis X. It has been shown to have anti-tumor activity by inhibiting endothelial growth and inducing apoptosis in cancer cells. CD15 antibody can also be used in combination with other antibodies, such as anti-CD33 antibody or tyrosine kinase inhibitors, to enhance its cytotoxic effects. Additionally, CD15 antibody has shown neutralizing activity against vascular endothelial growth factor (VEGF) and tumor necrosis factor-alpha (TNF-α), which are important factors in promoting tumor growth and inflammation. This antibody has demonstrated efficacy in various cancer models, including MCF-7 breast cancer cells and circumsporozoite protein-expressing tumors. Its potential therapeutic applications make CD15 antibody a promising candidate for targeted cancer therapy.GTPBP2 antibody
GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEHCD71 antibody
The CD71 antibody is a powerful tool in the field of Life Sciences. This steroid-based antibody specifically targets the CD71 molecule, also known as transferrin receptor 1. It plays a crucial role in iron metabolism and is highly expressed on the surface of proliferating cells.
CDK2 antibody
The CDK2 antibody is an essential tool in the field of Life Sciences. It is an antigen that has antiviral properties and can be used to neutralize harmful viruses. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs.
PRD antibody
PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRLPLC beta 2 antibody
The PLC beta 2 antibody is a highly specialized antibody used in the field of Life Sciences. It is a low-molecular-weight antibody that specifically targets PLC beta 2, an important protein involved in cell signaling pathways. This antibody is commonly used in research and diagnostic applications to study the role of PLC beta 2 in various biological processes.p63 antibody
The p63 antibody is a powerful tool in the field of Life Sciences. It is an activated antibody that specifically targets and binds to the her2 protein, making it an effective anti-her2 antibody. This antibody plays a crucial role in various research applications, including studying epidermal growth factor signaling pathways, growth factor interactions, and cellular processes.KHK antibody
KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVBSG antibody
The BSG antibody is a low-molecular-weight monoclonal antibody that specifically targets transferrin, a growth factor involved in various biological processes. This antibody has been developed using a DNA aptamer derived from flavobacterium heparinum. It has shown high affinity and specificity for transferrin and can be used in various applications in the Life Sciences field.PPM1G antibody
PPM1G antibody was raised in mouse using recombinant human PPM1G (317-546aa) purified from E. coli as the immunogen.HECTD2 antibody
HECTD2 antibody was raised using the middle region of HECTD2 corresponding to a region with amino acids ALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLTIKYFWDVVLGCD86 antibody
The CD86 antibody is a pegylated monoclonal antibody that specifically binds to CD86, a protein involved in immune response regulation. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.HNRPD antibody
HNRPD antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP
MTA1 antibody
The MTA1 antibody is a highly specialized antibody that targets the MTA1 protein. This protein plays a crucial role in various cellular processes, including adiponectin signaling, adp-ribosyl cyclase activity, and the formation of amyloid plaques. The MTA1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the effects of MTA1.TSPYL4 antibody
TSPYL4 antibody was raised using the middle region of TSPYL4 corresponding to a region with amino acids QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLEDesmoglein 1 antibody
Desmoglein 1 antibody was raised in mouse using recombinant human polypeptide desmoglein 1, extracellular part EII, EIII and EIV as the immunogen.PPWD1 antibody
PPWD1 antibody was raised using the middle region of PPWD1 corresponding to a region with amino acids FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGLDHA antibody
The LDHA antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets lactate dehydrogenase A (LDHA), an enzyme involved in glycolysis. This antibody can be used for various applications, including the detection of LDHA in nuclear extracts or cell lysates, as well as for immunohistochemistry and Western blotting. The LDHA antibody has been shown to inhibit the activity of LDHA, making it a valuable tool for studying the role of this enzyme in cellular processes such as apoptosis and metabolism. Additionally, this antibody has been used to investigate the effects of LDHA inhibitors on cancer cells and to study the activation of serine proteases in immune responses. Whether you're conducting research or developing diagnostic assays, the LDHA antibody is an essential tool for your experiments.GPR17 antibody
The GPR17 antibody is a polyclonal antibody that targets the G protein-coupled receptor 17 (GPR17). This receptor plays a crucial role in various physiological processes, including urokinase plasminogen activator activity and growth factor signaling. The GPR17 antibody can be used in life sciences research to study the expression and function of this receptor in different cell types and tissues.
STAT5A antibody
The STAT5A antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes STAT5A, a protein involved in various cellular processes. This antibody has been extensively studied and proven to have high affinity and specificity for STAT5A.RBMS3 antibody
RBMS3 antibody was raised using the C terminal of RBMS3 corresponding to a region with amino acids TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKPCTCF antibody
The CTCF antibody is a highly effective neutralizing agent used in Life Sciences. It is designed to target specific proteins and block their activity, making it an essential tool for researchers and scientists. This antibody is formulated with excipients that ensure stability and efficacy. It has been extensively tested in human serum to ensure its safety and reliability.
Cathepsin L antibody
The Cathepsin L antibody is a monoclonal antibody that specifically targets the protein Cathepsin L. It has been extensively studied in the field of Life Sciences and has shown to have various important functions. This antibody has been found to interact with molecules such as fibrinogen, phosphatase, erythropoietin, lipoprotein lipase, collagen, interleukin-6, and β-catenin.ALOXE3 antibody
The ALOXE3 antibody is a highly specialized antibody that targets the protein mesothelin. Mesothelin is a chemokine that plays a crucial role in various biological processes, including cell growth and migration. This antibody can be used in different research applications, such as immunohistochemistry and western blotting, to detect and quantify mesothelin levels in human serum or tissue samples.EXOSC7 antibody
EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVDLIN28 antibody
The LIN28 antibody is a protein molecular inhibitor that targets the fatty acid transporter. It is a monoclonal antibody used in life sciences research and as a reagent for immunohistochemistry. This antibody specifically inhibits glutaminase, an enzyme involved in the metabolism of glutamine. By blocking the activity of glutaminase, the LIN28 antibody may have potential therapeutic applications as a chemotherapeutic agent. Its high specificity and affinity make it an ideal tool for studying the role of glutaminase in various cellular processes and diseases.PAPPA antibody
The PAPPA antibody is a cytotoxic monoclonal antibody that is used in immunoassays to detect and neutralize the activity of pregnancy-associated plasma protein A (PAPPA). PAPPA is an enzyme that cleaves insulin-like growth factor-binding proteins (IGFBPs), thereby releasing insulin-like growth factors (IGFs) and promoting cell proliferation. The PAPPA antibody specifically binds to PAPPA, preventing its interaction with IGFBPs and inhibiting its enzymatic activity. This antibody can be used in research and diagnostic applications to study the role of PAPPA in various biological processes, including fetal development, cancer progression, and cardiovascular diseases. With its high specificity and affinity for PAPPA, the monoclonal antibody provides reliable results in experiments involving the detection and quantification of this important biomarker.p16 INK4a antibody
The p16 INK4a antibody is a specific antibody used in Life Sciences research. It is a polyclonal antibody that targets the cyclin-dependent kinase inhibitor p16 INK4a. This antibody specifically recognizes and binds to the conformational epitope of p16 INK4a, allowing for accurate detection and quantification of this protein in various biological samples. The p16 INK4a antibody has been widely used in studies investigating cell cycle regulation, tumor suppression, and epidermal growth factor signaling pathways. Its high specificity and sensitivity make it a valuable tool for researchers studying the role of p16 INK4a in cellular processes and disease development.P2RX7 antibody
The P2RX7 antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets and activates P2RX7, a receptor involved in various cellular processes. This antibody can be used in research applications to study the function and regulation of P2RX7.
