Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
CARS antibody
CARS antibody was raised using the N terminal of CARS corresponding to a region with amino acids MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVYpLDH antibody
pLDH antibody is a monoclonal antibody that specifically targets the enzyme lactate dehydrogenase (LDH). LDH is found in various tissues, including adipose tissue and adipocytes. This antibody can be used for research purposes in the field of life sciences to study the expression and function of LDH in different cell types. The pLDH antibody recognizes a specific antigenic site on LDH and can be used to detect its presence in samples. It has been extensively validated for its specificity and sensitivity in various experimental settings. This antibody is commonly used in immunohistochemistry, western blotting, and ELISA assays. By targeting LDH, this antibody provides researchers with a valuable tool to investigate the role of this enzyme in cellular processes such as energy metabolism, glycolysis, and cancer development. Additionally, it can be used to study the effects of LDH inhibitors or other therapeutic interventions on cellular functions. With its high affinity and specificity, the pLDH antibody offersDegré de pureté :>90% PureIGF2 antibody
IGF2 antibody was raised in rabbit using highly pure recombinant human IGF-II (human IGF-II) as the immunogen.TRPV6 antibody
The TRPV6 antibody is a highly specialized biomolecule used in Life Sciences research. It is a monoclonal antibody that specifically targets the TRPV6 protein, which plays a crucial role in calcium transport across cell membranes. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry.V5 antibody
The V5 antibody is a monoclonal antibody that targets hepatocyte growth. It is also known as an anti-HER2 antibody, and it belongs to the group of antibodies that inhibit the function of HER2 protein. The V5 antibody has been extensively studied in Life Sciences and has shown promising results in various applications. It has been found to bind to specific proteins such as collagen and fibronectin, thereby inhibiting their activity. Additionally, the V5 antibody has been shown to block the action of VEGF-C, which is a key factor in endothelial growth. This antibody can also interfere with signaling pathways involving epidermal growth factor and β-catenin. Overall, the V5 antibody offers a valuable tool for researchers studying hepatocyte growth and related processes.GOT2 antibody
The GOT2 antibody is a highly specialized product in the field of Life Sciences. It is an endothelial growth factor that plays a crucial role in various biological processes. This antibody is specifically designed to target and bind to the GOT2 antigen, which is involved in cell growth and proliferation.TK antibody
The TK antibody is a monoclonal antibody that specifically binds to TK (Thymidine Kinase), a protein involved in DNA synthesis. It is commonly used in research and diagnostic applications to detect the presence of TK or to study its function. The TK antibody can be used in various immunoassays, such as ELISA or Western blotting, to accurately measure the levels of TK in samples. This antibody has high specificity and sensitivity, making it an ideal tool for researchers in the field of Life Sciences. Additionally, the TK antibody can also be used for therapeutic purposes, targeting specific receptors or antigens associated with diseases such as cancer. Its binding properties allow for precise targeting and potential treatment options. With its robust binding capabilities and wide range of applications, the TK antibody is an essential tool for scientists and clinicians alike.
EPB41 antibody
EPB41 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQInvolucrin antibody
Involucrin antibody was raised using the N terminal of IVL corresponding to a region with amino acids AENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEPIAS2 antibody
PIAS2 antibody was raised using the N terminal of PIAS2 corresponding to a region with amino acids RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTCXORF20 antibody
CXORF20 antibody was raised using the middle region of Cxorf20 corresponding to a region with amino acids DGGEGCSWMFQPMNNSKMREKRNLQPNSNAIPEGMREPSTDNPEEPGEAWUSP12 antibody
USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGMMP14 antibody
The MMP14 antibody is a polyclonal antibody that is used in bioassays and research within the field of Life Sciences. It has been shown to have intraocular activity and can target amyloid plaques, which are associated with certain neurodegenerative diseases. This antibody specifically binds to the tyrosine kinase receptor and inhibits its activity, preventing the activation of downstream signaling pathways such as PI3-kinase/Akt/mTOR, which are involved in cell growth and survival. The MMP14 antibody can also be used in immunoassays to detect activated protein kinases and has been shown to have anti-beta amyloid properties. Whether used alone or in combination with other antibodies, this monoclonal antibody is a valuable tool for researchers studying various biological processes.FOXA2 antibody
FOXA2 antibody was raised in Mouse using a purified recombinant fragment of FOXA2 expressed in E. coli as the immunogen.SULT1A1 antibody
SULT1A1 antibody was raised using the N terminal of SULT1A1 corresponding to a region with amino acids ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTGIT1 antibody
The GIT1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and bind to activated cytidine in order to facilitate various research applications. This antibody is commonly used in studies related to insulin, cytotoxicity, adeno-associated virus (AAV), autoantibodies, growth factors, and DNA aptamers. The GIT1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options that best suit their specific needs. With its ability to recognize and interact with specific targets, this antibody plays a crucial role in advancing scientific understanding and discovery.VDBP antibody
VDBP antibody is a monoclonal antibody that specifically targets and binds to vitamin D binding proteins (VDBPs). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. VDBP antibody has shown promising results in inhibiting the activity of tyrosine kinase receptors, which play a crucial role in cell growth and proliferation. By blocking these receptors, VDBP antibody can potentially halt the progression of certain types of cancer.cMet antibody
The cMet antibody is a highly reactive monoclonal antibody that is used in various bioassays and research applications in the field of Life Sciences. It has been specifically designed to target and neutralize autoantibodies, which are antibodies that mistakenly attack healthy cells or tissues. This antibody has shown great potential in studying the role of cMet, a protein involved in cell signaling and growth regulation.
LRP2BP antibody
LRP2BP antibody was raised using the middle region of LRP2BP corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSEJAKMIP1 antibody
JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDEDCLRE1C antibody
DCLRE1C antibody was raised using a synthetic peptide corresponding to a region with amino acids SQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLLSSQERFactor X antibody
Factor X antibody was raised in sheep using human Factor X purified from plasma as the immunogen.Ku80 antibody
The Ku80 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It has been extensively studied and proven to have numerous applications in various fields. This antibody is particularly valuable for its ability to neutralize specific targets, including glutamate and TGF-beta, which are key molecules involved in various cellular processes.CACNB1 antibody
CACNB1 antibody was raised using the C terminal of CACNB1 corresponding to a region with amino acids RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQEEIF3E antibody
EIF3E antibody was raised using the N terminal of EIF3E corresponding to a region with amino acids ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
HOXA1 antibody
The HOXA1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the HOXA1 protein, which plays a crucial role in embryonic development and cellular growth. This antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA assays.
BMP10 antibody
The BMP10 antibody is a monoclonal antibody that targets β-catenin, a protein involved in cell signaling and development. It has been shown to neutralize the activity of BMP10, a growth factor that regulates various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has demonstrated its ability to inhibit the proliferation and migration of cells by disrupting the interaction between β-catenin and other proteins. Additionally, the BMP10 antibody has been found to induce apoptosis, or programmed cell death, through the fas-mediated pathway. Its cytotoxic effects make it a promising candidate for therapeutic applications in diseases such as cancer. Furthermore, this antibody has shown potential in inhibiting fibrinogen-induced platelet aggregation and reducing interleukin-6 production. Overall, the BMP10 antibody offers exciting possibilities for research and development in various fields related to cellular biology and disease treatment.ARPC3 antibody
ARPC3 antibody was raised using the middle region of ARPC3 corresponding to a region with amino acids ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPFLJ11730 antibody
FLJ11730 antibody was raised using the N terminal Of Flj11730 corresponding to a region with amino acids HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMASK1 antibody
The ASK1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody specifically designed to target and neutralize histidine, a key component involved in various biological processes. This antibody has shown great potential in research and therapeutic applications.
Biotin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.MP1 antibody
The MP1 antibody is a monoclonal antibody that specifically targets the carbonyl group found in various compounds. It is highly acidic and has been shown to bind to human serum, making it an ideal tool for diagnostic purposes. The MP1 antibody can also be used to detect autoantibodies, such as those targeting thymidylate or insulin. In addition, this antibody has demonstrated its effectiveness in Life Sciences research, particularly in the study of glial fibrillary acidic protein (GFAP) and growth factors like epidermal growth factor (EGF) and insulin-like growth factor (IGF). With its high specificity and versatility, the MP1 antibody is a valuable tool for scientists and researchers in a wide range of fields.
CD107a antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy through the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, this drug specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
DTX2 antibody
DTX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLEFerritin light chain antibody
The Ferritin light chain antibody is a specific antibody that targets the ferritin light chain protein. This protein plays a crucial role in iron storage and transport within cells. The antibody is a monoclonal antibody, meaning it is produced from a single clone of cells and has high specificity for its target.PSAT1 antibody
The PSAT1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets the cholinergic basic protein PSAT1, which plays a crucial role in various biological processes. The PSAT1 antibody is commonly used for research purposes, including the study of protein interactions, signal transduction pathways, and cellular functions.DCUN1D1 antibody
DCUN1D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK
