Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Myb antibody
The Myb antibody is a polyclonal antibody that specifically targets annexin A2. It is commonly used in research and laboratory settings to study the function and regulation of annexin A2. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and immunofluorescence assays. The Myb antibody has been proven to be highly specific and sensitive, providing reliable results in experiments. It can also be used in combination with other antibodies or inhibitors to study the interaction between annexin A2 and other molecules, such as chemokines or glucagon. Whether you are studying cardiomyocytes or conducting multidrug resistance assays, the Myb antibody is an essential tool for your research needs.SOX9 antibody
The SOX9 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly used for immunoassays and research purposes. This antibody specifically targets the SOX9 protein, which is a critical growth factor involved in various cellular processes. The SOX9 antibody can be utilized to study the expression and localization of this protein in different tissues and cell types.ESD antibody
ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
TUBB3 antibody
TUBB3 antibody was raised in Mouse using a purified recombinant fragment of human TUBB3 expressed in E. coli as the immunogen.CD68 antibody
The CD68 antibody is a monoclonal antibody that specifically targets the CD68 protein. CD68 is a glycoprotein that is predominantly expressed in macrophages and monocytes. This antibody has been widely used in Life Sciences research to study the activation of macrophages and the role of CD68 in various cellular processes.MPK6 antibody
The MPK6 antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the tyrosine kinase receptor and is commonly used in studies related to growth factors and cytotoxicity. This antibody has been shown to bind to carbonyl reductase and has potential applications in immunohistochemistry experiments. Additionally, it can be used in antibody-drug conjugates for targeted therapy. The MPK6 antibody is highly specific and reliable, making it an essential tool for researchers in the field of Life Sciences.ETV6 antibody
ETV6 antibody is a highly specialized antibody that targets the ETV6 protein, which is involved in regulating cell growth and development. It has been shown to inhibit the activity of this growth factor in various biological systems, including liver microsomes. The ETV6 antibody can be used as an inhibitor in research studies investigating the role of ETV6 in different cellular processes, such as collagen synthesis or TGF-β1 signaling. This product is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific experimental needs. The ETV6 antibody belongs to the category of antibodies used in life sciences research and has been extensively validated for its specificity and reliability. In addition to its applications in basic research, this antibody may also have potential therapeutic uses, particularly in targeting diseases involving abnormal ETV6 activity, such as certain types of cancers or neurological disorders.ERAB antibody
The ERAB antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets c-myc, a protein involved in various cellular processes such as cell growth and proliferation. The ERAB antibody can be used for applications such as immunohistochemistry, immunofluorescence, and Western blotting to detect the presence and localization of c-myc in different tissues and cell types.NMDAR1 antibody
The NMDAR1 antibody is a diagnostic reagent that belongs to the class of antibodies. It has excellent pharmacokinetic properties and is commonly used in Life Sciences research. The antibody is designed to specifically bind to NMDAR1, a biomolecule involved in various cellular processes such as synaptic plasticity and learning. It can be used for applications such as immunohistochemistry, Western blotting, and flow cytometry.
Fibrinogen antibody (HRP)
Fibrinogen antibody (HRP) was raised in sheep using human factor VIIIc as the immunogen.PIK3R3 antibody
The PIK3R3 antibody is a powerful tool in the field of biomedical research. It specifically targets lyso-gb1, an antigen that plays a crucial role in various cellular processes. This polyclonal antibody can be used to detect and study the expression of lyso-gb1 in different tissues and cell types.
C20ORF160 antibody
C20ORF160 antibody was raised using the N terminal Of C20Orf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLLSOAT1 antibody
SOAT1 antibody was raised in rabbit using the middle region of SOAT1 as the immunogenDegré de pureté :Min. 95%DCDC2 antibody
DCDC2 antibody was raised using the middle region of DCDC2 corresponding to a region with amino acids KGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNS
ACSL4 antibody
ACSL4 antibody was raised using the N terminal of ACSL4 corresponding to a region with amino acids AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK
Degré de pureté :Min. 95%IKZF3 antibody
The IKZF3 antibody is a highly specialized monoclonal antibody that has been developed for the detection and treatment of various medical conditions. This antibody specifically targets IKZF3, a protein that plays a crucial role in regulating immune responses and cell growth.GFAP antibody
The GFAP antibody is a highly specialized antibody used in Life Sciences research. It is produced by immunizing animals with bovine γ-globulin and generating polyclonal or monoclonal antibodies. This antibody specifically targets glial fibrillary acidic protein (GFAP), which is expressed in astrocytes, a type of glial cell in the central nervous system.GJC1 antibody
GJC1 antibody was raised using the N terminal of GJC1 corresponding to a region with amino acids IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFP2RX2 antibody
P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHPMM1 antibody
PMM1 antibody was raised using the N terminal of PMM1 corresponding to a region with amino acids MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVHSD17B6 antibody
HSD17B6 antibody was raised using the N terminal of HSD17B6 corresponding to a region with amino acids MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
HDAC4 antibody
The HDAC4 antibody is a highly specific monoclonal antibody that is used for the treatment and/or prophylaxis of various diseases. It is commonly used in immunoassays and research studies in the field of Life Sciences. This antibody can be immobilized on an electrode or coupled with streptavidin for quantitation purposes. The HDAC4 antibody has been shown to have anti-angiogenic properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. Its high specificity and affinity make it an ideal tool for the detection and analysis of HDAC4 in human serum samples. Additionally, this antibody can be used as an inhibitor to study the role of HDAC4 in various cellular processes, such as gene expression and protein regulation. With its wide range of applications, the HDAC4 antibody is a valuable tool for researchers in both academia and industry.RD3 antibody
RD3 antibody was raised using the N terminal of RD3 corresponding to a region with amino acids GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDVIFN γ antibody (biotin)
IFN Gamma antibody (biotin) was raised in rabbit using highly pure recombinant murine IFN-gamma as the immunogen.HECA antibody
HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFDegré de pureté :Min. 95%SKP2 antibody
SKP2 antibody was raised in Mouse using a purified recombinant fragment of SKP2(aa1-130) expressed in E. coli as the immunogen.SPR antibody
SPR antibody was raised in rabbit using the C terminal of SPR as the immunogenDegré de pureté :Min. 95%CHEK2 antibody
CHEK2 antibody was raised in rabbit using the N terminal of CHEK2 as the immunogen
Degré de pureté :Min. 95%Fibronectin antibody
The Fibronectin antibody is a highly specialized antibody that specifically targets fibronectin, a protein involved in cell adhesion and tissue repair. This polyclonal antibody is derived from human serum and has been extensively tested for its specificity and efficacy.
Cathepsin B antibody
The Cathepsin B antibody is a highly specialized monoclonal antibody that is designed to neutralize the activity of Cathepsin B in human serum. This antibody specifically targets and binds to Cathepsin B, preventing its interaction with other molecules such as TGF-beta, albumin, glutamate, dopamine, and growth factors. By blocking the activity of Cathepsin B, this antibody helps regulate cellular processes and maintain homeostasis in the body.LOC339047 antibody
LOC339047 antibody was raised using the middle region of LOC339047 corresponding to a region with amino acids ECLLTPLPPSALPSADDNLKTPAECLLYPLPPSADDNLKTPPECLLTPLPTMPRSS11D antibody
TMPRSS11D antibody was raised using the N terminal of TMPRSS11D corresponding to a region with amino acids RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRARat Pan Macrophages antibody
Rat pan macrophages antibody was raised in mouse using rat peritoneal macrophages as the immunogen.FRK antibody
The FRK antibody is a highly specialized antibody that has anti-thrombotic properties. It works by targeting and neutralizing the interleukin molecules that are responsible for blood clotting. This antibody is particularly effective against autoantibodies, which are antibodies that mistakenly attack healthy cells and tissues in the body. The FRK antibody is an important intermediate in the development of new medicaments and therapies for various diseases. It has been extensively tested and proven to be safe and effective in preclinical studies using adeno-associated virus as a delivery system. Polyclonal Antibodies, such as the FRK antibody, are widely used in Life Sciences research as powerful tools for studying protein function and localization. They can also be used as inhibitors or therapeutic medicines to target specific proteins or pathways in the body. If you're looking for a reliable and high-quality antibody for your research or medical needs, the FRK antibody is an excellent choice.FAM76A antibody
FAM76A antibody was raised using the N terminal of FAM76A corresponding to a region with amino acids MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKCYP11B1 antibody
CYP11B1 antibody was raised in rabbit using the C terminal of CYP11B1 as the immunogenDegré de pureté :Min. 95%Merlin antibody
The Merlin antibody is a growth factor that is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including collagen synthesis and cell proliferation. The antibody acts as a neutralizing agent against inhibitors that may hinder these processes, allowing for optimal growth and development.PM20D2 antibody
PM20D2 antibody was raised using the middle region of PM20D2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALASJAB1 antibody
The JAB1 antibody is a polyclonal antibody that has shown inhibitory effects on the rapamycin complex. It is a potential inhibitor of antileukemic activity and has been extensively studied in the field of Life Sciences. The JAB1 antibody binds to specific targets, including proteins with a hydroxyl group, such as morphogenetic protein and collagen. This antibody has shown promising results in the development of pharmaceutical preparations and may have applications in the treatment of various diseases. With its ability to target specific molecules, the JAB1 antibody holds great potential as a therapeutic agent or as a tool for research purposes.Calcitonin antibody
Calcitonin antibody is a specialized product used in the field of Life Sciences. It acts as an immunosuppressant and inhibitor, targeting specific molecules and pathways in the body. This antibody is colloidal in nature and can be used in various applications such as research, diagnostics, and therapeutics.MIP1 beta antibody
MIP1 beta antibody was raised in rabbit using highly pure recombinant human MIP1 beta as the immunogen.PPIA antibody
The PPIA antibody is a highly specialized monoclonal antibody that targets the protein peptidyl-prolyl cis-trans isomerase A (PPIA). This acidic antibody has been extensively studied in the field of Life Sciences and has shown great potential in various applications.Vav antibody
The Vav antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect Vav proteins, which play a crucial role in signaling pathways associated with various diseases, including mucopolysaccharidosis type. This antibody has a high affinity for Vav proteins and can be used in experiments such as Western blotting, immunohistochemistry, and flow cytometry.Alpha-fetoprotein antibody
The Alpha-fetoprotein antibody is a transmembrane conductance protein that plays a crucial role in binding proteins and inhibitors. It is a monoclonal antibody that targets specific growth factors and chemokines, inhibiting their activity. This antibody has been shown to effectively block tyrosine phosphorylation and downstream signaling pathways, making it a valuable tool in research and therapeutic applications. Additionally, the Alpha-fetoprotein antibody has been used to detect autoantibodies and glycoproteins associated with various diseases in the field of Life Sciences. Its ability to inhibit angiogenic inducers makes it a promising candidate for anti-cancer therapies.XRCC5 antibody
XRCC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
