Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75602 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
NFKBIL1 antibody
NFKBIL1 antibody was raised in rabbit using the N terminal of NFKBIL1 as the immunogenDegré de pureté :Min. 95%LRCH4 antibody
LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLMTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVPDegré de pureté :Min. 95%NXT1 antibody
NXT1 antibody was raised in rabbit using the N terminal of NXT1 as the immunogen
Degré de pureté :Min. 95%ZNF264 antibody
ZNF264 antibody was raised in rabbit using the N terminal of ZNF264 as the immunogen
Degré de pureté :Min. 95%Fmo4 antibody
Fmo4 antibody was raised in rabbit using the middle region of Fmo4 as the immunogenDegré de pureté :Min. 95%RAD54B antibody
RAD54B antibody was raised using a synthetic peptide corresponding to a region with amino acids DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV
Degré de pureté :Min. 95%HMGB4 antibody
HMGB4 antibody was raised in rabbit using the N terminal of HMGB4 as the immunogenDegré de pureté :Min. 95%Abcb10 antibody
Abcb10 antibody was raised in rabbit using the N terminal of Abcb10 as the immunogenDegré de pureté :Min. 95%RGS4 antibody
RGS4 antibody was raised using the C terminal of RGS4 corresponding to a region with amino acids EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL
Degré de pureté :Min. 95%PDIA6 antibody
PDIA6 antibody was raised using the N terminal of PDIA6 corresponding to a region with amino acids KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSDegré de pureté :Min. 95%C19ORF46 antibody
C19ORF46 antibody was raised using the N terminal Of C19Orf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPADegré de pureté :Min. 95%RAGE antibody
RAGE antibody was raised in rabbit using the middle region of RAGE as the immunogenDegré de pureté :Min. 95%SFTPD antibody
SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSADegré de pureté :Min. 95%ADAR antibody
ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS
Degré de pureté :Min. 95%ALDH9A1 antibody
ALDH9A1 antibody was raised in rabbit using the C terminal of ALDH9A1 as the immunogenDegré de pureté :Min. 95%Influenza A antibody
The Influenza A antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to the influenza A virus, preventing its replication and spread. It has been shown to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. Additionally, this antibody has been found to inhibit hemolysis, a process where red blood cells are destroyed. It also exhibits anti-vascular endothelial growth factor (anti-VEGF) activity, blocking the growth of new blood vessels that can contribute to tumor development. Furthermore, it has been shown to neutralize chemokines, which are signaling proteins involved in immune cell recruitment. The Influenza A antibody is an essential tool for researchers studying viral infections and autoimmune diseases. Its versatility and effectiveness make it a valuable asset in various scientific disciplines.Degré de pureté :Min. 95%ZDHHC18 antibody
ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIIDegré de pureté :Min. 95%RASGRF1 antibody
RASGRF1 antibody was raised using the N terminal of RASGRF1 corresponding to a region with amino acids RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDegré de pureté :Min. 95%RNF139 antibody
RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPRDegré de pureté :Min. 95%Fmr1 antibody
Fmr1 antibody was raised in rabbit using the C terminal of Fmr1 as the immunogenDegré de pureté :Min. 95%AGXT2 antibody
AGXT2 antibody was raised using the N terminal of AGXT2 corresponding to a region with amino acids TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQKDegré de pureté :Min. 95%St6galnac1 antibody
St6galnac1 antibody was raised in rabbit using the C terminal of St6galnac1 as the immunogenDegré de pureté :Min. 95%Lpcat2 antibody
Lpcat2 antibody was raised in rabbit using the N terminal of Lpcat2 as the immunogenDegré de pureté :Min. 95%CEACAM7 antibody
CEACAM7 antibody was raised in rabbit using the C terminal of CEACAM7 as the immunogenDegré de pureté :Min. 95%LTBP4 antibody
The LTBP4 antibody is a specific antibody that binds to the latent transforming growth factor-beta (TGF-β) binding protein 4 (LTBP4). It has been shown to inhibit the activity of TGF-β, a key growth factor involved in various cellular processes. The LTBP4 antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA. It has also been used to detect autoantibodies in human serum samples and to study the role of LTBP4 in diseases such as cancer and autoimmune disorders. This high-quality polyclonal antibody is produced using advanced techniques in Life Sciences and is validated for its specificity and performance. With its reliable results and broad applications, the LTBP4 antibody is an essential tool for researchers studying TGF-β signaling pathways and related biological processes.Degré de pureté :Min. 95%PIGF antibody
PIGF antibody was raised in rabbit using highly pure recombinant human PlGF as the immunogen.Degré de pureté :Min. 95%MCP4 antibody
MCP4 antibody was raised in rabbit using highly pure recombinant hMCP-4 as the immunogen.Degré de pureté :Min. 95%EDIL3 antibody
EDIL3 antibody was raised in rabbit using the N terminal of EDIL3 as the immunogenDegré de pureté :Min. 95%AP3S1 antibody
AP3S1 antibody was raised in rabbit using the C terminal of AP3S1 as the immunogenDegré de pureté :Min. 95%KLK-L1 antibody
KLK-L1 antibody was raised in rabbit using residues 242-254 [KFTEWIEKTVQAS] of the human 39 kDa KLK-L1 (KLK4) protein as the immunogen.Degré de pureté :Min. 95%GSG1 antibody
GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQPDegré de pureté :Min. 95%Rpia antibody
Rpia antibody was raised in rabbit using the middle region of Rpia as the immunogen
Degré de pureté :Min. 95%Rasa1 antibody
Rasa1 antibody was raised in rabbit using the C terminal of Rasa1 as the immunogen
Degré de pureté :Min. 95%TAU antibody
The TAU antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to fatty acids in the nucleus, allowing researchers to study their role in various cellular processes. Additionally, the TAU antibody has shown promising results as an anti-VEGF (vascular endothelial growth factor) therapy, inhibiting the growth of blood vessels and potentially offering new treatment options for diseases such as cancer. Furthermore, this antibody has been found to interact with natriuretic hormones and fibroins, suggesting its involvement in regulating blood pressure and tissue repair. In laboratory studies, the TAU antibody has demonstrated its ability to inhibit caspase-9 activity, a key enzyme involved in programmed cell death. With its high specificity and versatility, the TAU antibody is a valuable tool for researchers seeking to unravel the complexities of cellular pathways and develop novel therapeutic strategies.Degré de pureté :Min. 95%EGFR antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its effectiveness through various techniques such as patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Degré de pureté :Min. 95%CLEC4M antibody
CLEC4M antibody was raised using the middle region of CLEC4M corresponding to a region with amino acids NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSDegré de pureté :Min. 95%PUMA antibody
PUMA antibody was raised in rabbit using 17 residue sequence 29-55 [EQHLESPVPSAPGALAG] found in the exon-3-encoded region in the human PUMA-Alpha and PUMA-Beta forms of the protein as the immunogen.
Degré de pureté :Min. 95%MASP2 antibody
MASP2 antibody was raised using the N terminal of MASP2 corresponding to a region with amino acids FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKDegré de pureté :Min. 95%LCAT antibody
LCAT antibody was raised using the C terminal of LCAT corresponding to a region with amino acids GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTLDegré de pureté :Min. 95%TP53RK antibody
TP53RK antibody was raised in rabbit using the N terminal of TP53RK as the immunogenDegré de pureté :Min. 95%WT1 antibody
WT1 antibody was raised in rabbit using the N terminal of WT1 as the immunogen
Degré de pureté :Min. 95%TMED10 antibody
TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF
Degré de pureté :Min. 95%GLMN antibody
GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLDegré de pureté :Min. 95%CLTA antibody
CLTA antibody was raised in rabbit using the C terminal of CLTA as the immunogenDegré de pureté :Min. 95%HFE antibody
HFE antibody was raised using the N terminal of HFE corresponding to a region with amino acids MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWDegré de pureté :Min. 95%ZNF284 antibody
ZNF284 antibody was raised in rabbit using the middle region of ZNF284 as the immunogenDegré de pureté :Min. 95%GABABR1 antibody
GABABR1 antibody was raised in rabbit using residues 33-54 [PHLPRPHPRVPPHPSSERRAVY] of the GABABR1 subunit as the immunogen.Degré de pureté :Min. 95%Pdyn antibody
Pdyn antibody was raised in rabbit using the middle region of Pdyn as the immunogenDegré de pureté :Min. 95%STX4 antibody
STX4 antibody was raised in rabbit using the C terminal of STX4 as the immunogenDegré de pureté :Min. 95%PRDM6 antibody
PRDM6 antibody was raised in rabbit using the N terminal of PRDM6 as the immunogenDegré de pureté :Min. 95%LOC91664 antibody
LOC91664 antibody was raised in rabbit using the middle region of LOC91664 as the immunogen
Degré de pureté :Min. 95%CRYBA4 antibody
CRYBA4 antibody was raised in rabbit using the middle region of CRYBA4 as the immunogenDegré de pureté :Min. 95%PSDR1 antibody
PSDR1 antibody was raised in rabbit using N terminal sequence MVELMFP and C terminal sequence LLGLPID of the human PSDR1 protein as the immunogen.Degré de pureté :Min. 95%SPP1 antibody
SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQDegré de pureté :Min. 95%THEG antibody
THEG antibody was raised in rabbit using the middle region of THEG as the immunogenDegré de pureté :Min. 95%Mn SOD antibody
Mn SOD antibody was raised in rabbit using native rat Mn SOD as the immunogen.
Degré de pureté :Min. 95%VHL antibody
VHL antibody was raised in rabbit using the N terminal of VHL as the immunogen
Degré de pureté :Min. 95%SELS antibody
SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
Degré de pureté :Min. 95%IGFBP2 antibody
IGFBP2 antibody was raised using the middle region of IGFBP2 corresponding to a region with amino acids KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQDegré de pureté :Min. 95%MMP23B antibody
MMP23B antibody was raised using the middle region of MMP23B corresponding to a region with amino acids QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVVDegré de pureté :Min. 95%SLC29A2 antibody
SLC29A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVDegré de pureté :Min. 95%C6orf182 antibody
C6orf182 antibody was raised in rabbit using the middle region of C6orf182 as the immunogenDegré de pureté :Min. 95%Selenoprotein antibody
Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSDegré de pureté :Min. 95%Follistatin antibody
Follistatin antibody was raised in rabbit using highly pure recombinant human Follistatin as the immunogen.
Degré de pureté :Min. 95%TIE2 antibody
TIE2 antibody was raised in rabbit using a 20 amino acid peptide from human TIE2 as the immunogen.Degré de pureté :Min. 95%IL1RL1 antibody
IL1RL1 antibody was raised using the N terminal of IL1RL1 corresponding to a region with amino acids RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCDegré de pureté :Min. 95%PPP2R3B antibody
PPP2R3B antibody was raised using a synthetic peptide corresponding to a region with amino acids TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETADegré de pureté :Min. 95%CETP antibody
CETP antibody was raised using the middle region of CETP corresponding to a region with amino acids KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEVDegré de pureté :Min. 95%FGF14 antibody
FGF14 antibody was raised in rabbit using the middle region of FGF14 as the immunogenDegré de pureté :Min. 95%CENPH antibody
CENPH antibody was raised using the middle region of CENPH corresponding to a region with amino acids ESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERI
Degré de pureté :Min. 95%MRGPRF antibody
MRGPRF antibody was raised in rabbit using the C terminal of MRGPRF as the immunogenDegré de pureté :Min. 95%EIF3H antibody
EIF3H antibody was raised in rabbit using the N terminal of EIF3H as the immunogen
Degré de pureté :Min. 95%AMBP antibody
AMBP antibody was raised in rabbit using the N terminal of AMBP as the immunogenDegré de pureté :Min. 95%EGFR antibody
The EGFR antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the cell antigen EGFR (epidermal growth factor receptor), which plays a crucial role in cell growth and proliferation. By binding to EGFR, this antibody inhibits the activation of growth factor signaling pathways, preventing uncontrolled cell division.Degré de pureté :Min. 95%FNDC8 antibody
FNDC8 antibody was raised in rabbit using the N terminal of FNDC8 as the immunogenDegré de pureté :Min. 95%Vamp1 antibody
Vamp1 antibody was raised in rabbit using the C terminal of Vamp1 as the immunogenDegré de pureté :Min. 95%DYSF antibody
DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids SRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKDegré de pureté :Min. 95%RTN1 antibody
RTN1 antibody was raised using the N terminal of RTN1 corresponding to a region with amino acids EEREAELDSELIIESCDASSASEESPKREQDSPPMKPSALDAIREETGVRDegré de pureté :Min. 95%LAPTM4B antibody
LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISDegré de pureté :Min. 95%MAGEE1 antibody
MAGEE1 antibody was raised in rabbit using the C terminal of MAGEE1 as the immunogenDegré de pureté :Min. 95%VISA antibody
VISA antibody was raised using the N terminal of VISA corresponding to a region with amino acids ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHDegré de pureté :Min. 95%SLC9A1 antibody
SLC9A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGDegré de pureté :Min. 95%DEGS1 antibody
DEGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVDegré de pureté :Min. 95%PPP2R5E antibody
PPP2R5E antibody was raised in rabbit using the N terminal of PPP2R5E as the immunogen
Degré de pureté :Min. 95%FSCN3 antibody
FSCN3 antibody was raised in rabbit using the middle region of FSCN3 as the immunogenDegré de pureté :Min. 95%SPRY2 antibody
SPRY2 antibody was raised in rabbit using the middle region of SPRY2 as the immunogenDegré de pureté :Min. 95%IL1 alpha antibody
IL1 alpha antibody was raised in rabbit using highly pure recombinant murine IL-1-alpha as the immunogen.Degré de pureté :Min. 95%ATP1B4 antibody
ATP1B4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVSDegré de pureté :Min. 95%DPP6 antibody
DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQDegré de pureté :Min. 95%SLC13A2 antibody
SLC13A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDDegré de pureté :Min. 95%ZNF300 antibody
ZNF300 antibody was raised in rabbit using the N terminal of ZNF300 as the immunogenDegré de pureté :Min. 95%CDK2 antibody
The CDK2 antibody is a highly specialized monoclonal antibody that targets the cyclin-dependent kinase 2 (CDK2) protein. This antibody is widely used in life sciences research to study the role of CDK2 in various cellular processes.
Degré de pureté :Min. 95%ADAR1 antibody
The ADAR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It has been extensively studied for its biochemical properties and reactivity. This antibody specifically targets ADAR1, an enzyme involved in RNA editing processes. It has been shown to have a high affinity for the chloride monomer and can be used for the immunohistochemical detection of ADAR1 in various tissues. Additionally, this antibody has been found to interact with epidermal growth factor and glucan synthase, indicating its potential role in growth factor signaling pathways. The ADAR1 antibody is a valuable tool for researchers studying RNA editing processes and its impact on cellular function.Degré de pureté :Min. 95%C3orf59 antibody
C3orf59 antibody was raised in rabbit using the C terminal of C3orf59 as the immunogen
Degré de pureté :Min. 95%ZNF431 antibody
ZNF431 antibody was raised in rabbit using the N terminal of ZNF431 as the immunogenDegré de pureté :Min. 95%
