Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
75602 produits trouvés pour "Anticorps primaires"
DSG3 antibody
DSG3 antibody is a monoclonal antibody used in the field of Life Sciences as an important tool for research and development. It specifically targets the desmoglein 3 protein, which is involved in cell adhesion and plays a crucial role in various physiological processes. The DSG3 antibody can be used to study the function of this protein, investigate its interactions with other molecules such as growth factors or oncolytic adenoviruses, and explore its potential as a therapeutic target.
IL18BP antibody
IL18BP antibody was raised in goat using highly pure recombinant murine IL-18BP as the immunogen.Degré de pureté :Min. 95%Treponema pallidum antibody
Treponema pallidum antibody was raised in rabbit using highly purified Treponema pallidum as the immunogen.
Degré de pureté :Min. 95%HSV1 gD antibody
HSV1 gD antibody was raised in mouse using herpes simplex I and II-infected cells as the immunogen.MIF antibody
The MIF antibody is a potent neutralizing agent that targets the growth factor and chemokine known as Macrophage Migration Inhibitory Factor (MIF). This polyclonal antibody binds to MIF, preventing its interaction with other molecules and inhibiting its biological activity. By blocking the action of MIF, this antibody can modulate immune responses, including the production of interferon and colony-stimulating factors. Additionally, it has antiviral properties and may play a role in regulating cell adhesion through interactions with E-cadherin. With its high specificity and effectiveness, the MIF antibody is a valuable tool for researchers studying immune responses and inflammatory diseases.
TFE3 antibody
TFE3 antibody is a highly specific antibody that targets the TFE3 protein, which is involved in regulating gene expression. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. It recognizes the antigen with high affinity and specificity, making it an essential tool for researchers in the Life Sciences field.
Degré de pureté :Min. 95%CIITA antibody
The CIITA antibody is a powerful tool in the field of immunology. This antibody specifically targets and binds to the CIITA antigen, which plays a crucial role in immune system regulation. By binding to CIITA, this antibody can modulate immune responses and has potential applications in various areas of research and medicine.
Selenophosphate synthetase 1 antibody
Affinity purified Rabbit polyclonal Selenophosphate synthetase 1 antibody
KIF5B antibody
KIF5B antibody was raised using the C terminal of KIF5B corresponding to a region with amino acids ANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLE
Degré de pureté :Min. 95%Calpain 2 antibody
Calpain 2 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-calpain as the immunogen.
CDC42 antibody
The CDC42 antibody is a highly specific and potent polyclonal antibody that targets the protein CDC42. It can also be used as a monoclonal antibody. CDC42 is a small GTPase protein that plays a crucial role in various cellular processes, including cell growth, migration, and differentiation. This antibody has been extensively tested and validated for its ability to neutralize the activity of CDC42, making it an invaluable tool for researchers in the field of life sciences.
CD49d antibody (PE)
CD49d antibody (PE) was raised in mouse using human CD49d as the immunogen.
Degré de pureté :Min. 95%IGFBP3 antibody
IGFBP3 antibody is a stable chemical compound that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes IGFBP3, which stands for insulin-like growth factor binding protein 3. This antibody has been extensively used in research and diagnostics to study the aberrant methylation and oxidative damage associated with IGFBP3.
Goat anti Rabbit IgG (H + L) (Fab'2) (HRP)
Goat anti-rabbit IgG (H+L) (Fab'2) (HRP) was raised in goat using rabbit IgG, whole molecule as the immunogen.
Degré de pureté :Min. 95%MRTO4 antibody
MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL
Rabbit anti Bovine IgG (biotin)
Rabbit anti-bovine IgG (biotin) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.Degré de pureté :Min. 95%Factor VIIIc antibody
Factor VIIIc antibody was raised in mouse using human factor VIII antigen as the immunogen.
Complement C3b beta antibody
Complement C3b beta antibody was raised in mouse using human complement component C3 as the immunogen.
HDAC8 antibody
The HDAC8 antibody is a highly specialized product used in the field of Life Sciences. It is an antibody that specifically targets and binds to histone deacetylase 8 (HDAC8), a nuclear enzyme involved in gene regulation. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
COL4A5 antibody
The COL4A5 antibody is a monoclonal antibody that specifically targets the collagen type IV alpha 5 chain. It can be used in various applications in Life Sciences research. This antibody has been shown to bind to collagen type IV and inhibit its activity, making it a valuable tool for studying the role of collagen in various cellular processes. Additionally, the COL4A5 antibody has been used in experiments involving creatine kinase activation and family kinase inhibition. Its efficacy has also been demonstrated in electrode-based assays. This antibody is highly specific and shows minimal cross-reactivity with other proteins. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the most suitable option for their experiments. The COL4A5 antibody is an essential tool for investigating the functions and mechanisms of collagen type IV and its associated pathways.
Degré de pureté :Min. 95%NGAL antibody
The NGAL antibody is a monoclonal antibody that specifically targets and binds to neutrophil gelatinase-associated lipocalin (NGAL). NGAL is an important protein involved in various biological processes, including inflammation, cell growth, and iron metabolism. This antibody can be used in research and diagnostic applications to detect NGAL levels in human serum or tissue samples. It is commonly used in life sciences and clinical laboratories for studying the role of NGAL in different diseases and conditions. The NGAL antibody can also be conjugated with streptavidin or other molecules for specific applications such as immunohistochemistry or ELISA. With its high specificity and sensitivity, this antibody is a valuable tool for researchers and healthcare professionals working in the field of molecular biology and diagnostics.
Delangin A antibody
Delangin A antibody was raised in Rat using Delangin peptide coupled to carrier protein as the immunogen.
Progesterone receptor antibody
The Progesterone receptor antibody is a highly specific monoclonal antibody that targets the progesterone receptor. It is designed to bind to the receptor and inhibit its activity, making it an essential tool for studying the role of progesterone in various biological processes.
PARVB antibody
PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVEDegré de pureté :Min. 95%MST1R antibody
MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Degré de pureté :Min. 95%C17ORF39 antibody
C17ORF39 antibody was raised using the C terminal Of C17Orf39 corresponding to a region with amino acids SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
SH3BGRL3 antibody
The SH3BGRL3 antibody is a theranostic tool used in the field of Life Sciences. It plays a crucial role in various biological processes and has been extensively studied for its potential therapeutic applications. This antibody specifically targets SH3BGRL3, a proline-rich protein involved in cytokine receptor signaling and caveolin-1 regulation.
DDX39 antibody
DDX39 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 39 (Ddx39)CD38 antibody (Allophycocyanin)
CD38 antibody (Allophycocyanin) was raised in rat using CD38 as the immunogen.
Degré de pureté :Min. 95%GNAL antibody
GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR
Rabbit anti Cat IgG
Rabbit anti-cat IgG was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.Degré de pureté :Min. 95%Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a polyclonal antibody that is commonly used in life sciences research. It is designed to specifically bind to tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays.
MMAB antibody
The MMAB antibody is an activated Monoclonal Antibody that is commonly used in Life Sciences research. It specifically targets insulin, a hormone involved in regulating blood sugar levels. This antibody can be used for various applications, including immunohistochemistry and the detection of interleukin-6 (IL-6) levels. The MMAB antibody has cytotoxic properties, meaning it can selectively kill cells expressing the target protein. Additionally, it has been shown to interact with other proteins such as butyrylcholinesterase, TRPV4, and actin. With its high specificity and affinity for its target, the MMAB antibody is a valuable tool for studying insulin-related processes and their implications in various diseases and disorders.KLRC1 antibody
The KLRC1 antibody is a polyclonal antibody that specifically targets the chemokine-activated receptor KLRC1. This antibody is commonly used in life sciences research and has been shown to have high affinity and specificity for KLRC1. It can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA. The KLRC1 antibody has been proven effective in detecting KLRC1 expression in human serum samples and has been used to study its role in various biological processes. This antibody has also been utilized in the development of therapeutic inhibitors targeting KLRC1 signaling pathways. With its reliable performance and versatility, the KLRC1 antibody is an essential tool for researchers studying protein kinases and their associated pathways.
Donkey anti Rabbit IgG (H + L) (rhodamine)
Donkey anti-rabbit IgG (H+L) (Rhodamine) was raised in donkey using rabbit IgG whole molecule as the immunogen.
Degré de pureté :Min. 95%SLUG antibody
The SLUG antibody is a monoclonal antibody that specifically targets a molecule called SLUG. It has cytotoxic properties, meaning it can kill cells that express SLUG. This antibody has been extensively studied and shown to be effective in various applications.
ZBTB26 antibody
ZBTB26 antibody was raised in rabbit using the middle region of ZBTB26 as the immunogen
Degré de pureté :Min. 95%CRELD1 antibody
CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
Neuropsin antibody
The Neuropsin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activated form of Neuropsin, an enzyme involved in various physiological processes. This antibody has been shown to inhibit the activity of Neuropsin, which plays a crucial role in fatty acid metabolism and the regulation of inflammatory responses.
JAK2 antibody
JAK2 antibody was raised in Mouse using a purified recombinant fragment of JAK2(745-955aa) expressed in E. coli as the immunogen.
CD152 antibody (Azide Free)
CD152 antibody (Azide free) was raised in hamster using murine CD152/CTLA-4 as the immunogen.
Degré de pureté :Min. 95%RAVER2 antibody
RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL
ApoJ antibody
ApoJ antibody was raised in goat using human apolipoprotein type J as the immunogen.Degré de pureté :Min. 95%Calcitonin antibody
Calcitonin antibody is a powerful tool used in life sciences research and diagnostics. It is a type of polyclonal antibody that specifically targets the growth hormone receptor. This antibody recognizes and binds to the receptor, blocking its activity and preventing the binding of growth hormone.
HIV1 gp41 antibody (HRP)
HIV1 gp41 antibody (HRP) was raised in goat using recombinant ectodomain of gp41 as the immunogen.WDR77 antibody
WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS
SGK3 antibody
SGK3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%
