Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
75602 produits trouvés pour "Anticorps primaires"
PRKACB antibody
The PRKACB antibody is a highly specific antibody that targets the protein kinase A catalytic subunit beta (PRKACB). This antibody is derived from a vaccine strain and has been extensively tested for its antigen specificity. It has shown high affinity and selectivity for PRKACB, making it an ideal tool for studying the function and regulation of this protein.
Neisseria Gonorrhoeae Antibody
Neisseria Gonorrhoeae Antibody is a growth factor that targets the annexin A2 protein. This monoclonal antibody has been developed to specifically bind to Neisseria gonorrhoeae, a bacteria responsible for causing the sexually transmitted infection gonorrhea. By targeting and binding to specific proteins on the surface of the bacteria, this antibody helps in neutralizing and eliminating the pathogen from the body. Additionally, this antibody has shown potential in inhibiting the attachment of N. gonorrhoeae to host cells, preventing its entry and subsequent infection.Ku70 antibody
The Ku70 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets and inhibits the activity of hepatocyte growth factor, a key growth factor involved in various cellular processes. This antibody can be used for research purposes to study the role of hepatocyte growth factor in different biological systems.
DNM1 antibody
The DNM1 antibody is a highly effective medicament that has shown promising results in inhibiting the growth of carcinoma cell lines. This monoclonal antibody specifically targets a growth factor that is essential for the proliferation of cancer cells, making it a potential breakthrough in cancer treatment. The DNM1 antibody has been extensively studied in Life Sciences and has been proven to be a potent inhibitor of tumor growth. Additionally, this antibody can be used as a selectable marker in research experiments due to its high specificity and sensitivity. With its ability to target specific markers expressed by cancer cells, the DNM1 antibody holds great potential for personalized medicine and targeted therapy approaches.
PPEF1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
Myc Tag antibody
The Myc Tag antibody is a highly reactive antibody that is commonly used in Life Sciences research. It specifically targets the Myc epitope, which is a small protein tag often fused to target proteins for detection and purification purposes. This antibody has been extensively validated and shown to have high affinity and specificity for the Myc tag.
PCBP2 antibody
The PCBP2 antibody is a polyclonal antibody that specifically targets the PCBP2 protein. This protein plays a crucial role in various biological processes, including regulation of insulin production and growth factor signaling. The PCBP2 antibody is widely used in life sciences research to study the function and expression of PCBP2.
Enterovirus antibody
Enterovirus antibody is a biomolecule that specifically targets the glycoprotein of enteroviruses. It is a monoclonal antibody that has been shown to have neutralizing properties against enteroviruses, preventing their ability to infect host cells. This antibody is widely used in Life Sciences research to study the mechanisms of enterovirus infection and develop potential antiviral therapies. Additionally, Enterovirus antibody can be used in diagnostic assays to detect the presence of enteroviruses in patient samples. Its high specificity and sensitivity make it a valuable tool for detecting and studying these viral infections.
MDR1 antibody
MDR1 antibody is a chemokine that belongs to the group of polyclonal antibodies. It targets the MDR1 protein, also known as P-glycoprotein, which plays a crucial role in multidrug resistance in cancer cells. The MDR1 antibody can be used for various applications, including telomerase detection, microsphere-based immunoassays, and helicobacter pylori diagnosis. It can also be used to detect autoantibodies and colloidal gold-labeled antibodies. Additionally, the MDR1 antibody has been shown to have anti-connexin agent activity and can inhibit annexin binding. It can be used as a substrate for siRNA delivery or as a monoclonal antibody for macrophage inflammatory response studies. The MDR1 antibody is an essential tool for researchers studying phosphorylcholine antigens and their interactions with immune cells.
Cytoglobin antibody
The Cytoglobin antibody is a polyclonal antibody that has been developed to target the Cytoglobin protein. This protein is involved in various biological processes, including cell growth and differentiation. The antibody can be used in research studies to investigate the role of Cytoglobin in different cellular pathways.
ALK antibody
The ALK antibody is a highly effective multidrug that is commonly used in immunoassays. This monoclonal antibody specifically targets the epidermal growth factor and histidine receptors, making it a versatile tool for various applications. The ALK antibody has been extensively studied and has shown excellent results in chemokine and cytotoxic assays, as well as in the detection of growth factors. It can be used in conjunction with other Polyclonal Antibodies to enhance its efficacy. The ALK antibody is activated upon binding to its target, allowing for accurate and reliable results. It is also compatible with ophthalmic formulations and can be used in colloidal or phosphatase-based assays. With its high specificity and sensitivity, the ALK antibody is an essential tool for researchers and clinicians alike.
CMTM6 antibody
The CMTM6 antibody is a hormone peptide that binds to specific proteins in the body. It is a powerful tool for researchers and healthcare professionals working in the field of hormone regulation. This antibody has been extensively studied and proven to be effective in various applications.
COX2 antibody
The COX2 antibody is a powerful tool used in immunoassay tests to detect the presence of cyclooxygenase-2 (COX-2) protein. This polyclonal antibody is produced by hybridoma cells and has high specificity for COX-2. It has been extensively tested and validated for use in various applications, including western blotting, immunohistochemistry, and flow cytometry.
CD44 antibody
The CD44 antibody is a powerful tool used in Life Sciences research. It belongs to the category of anti-ICOS antibodies and is widely used in various applications. This antibody specifically targets CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion, migration, and signaling.
NR2F6 antibody
NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
KLK7 antibody
The KLK7 antibody is a highly potent and specific monoclonal antibody that targets the KLK7 antigen. It has been widely used in Life Sciences research for its ability to detect and immobilize KLK7 in various applications. This antibody binds to KLK7 with high affinity, allowing for accurate and reliable detection of this protein. Additionally, the KLK7 antibody has been shown to have minimal cross-reactivity with other proteins, ensuring precise and specific results. It is commonly used in studies involving actin filaments, atypical hemolytic disorders, and nuclear localization of proteins. The KLK7 antibody is available in both purified and conjugated forms, making it versatile for a wide range of experimental needs. With its exceptional sensitivity and specificity, this antibody is an essential tool for researchers in the field of Life Sciences.
RPL9 antibody
RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
MC5R antibody
The MC5R antibody is a highly specialized monoclonal antibody that binds to the MC5 receptor, a specific type of receptor found in various cells throughout the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
RAD51A antibody
The RAD51A antibody is a highly specialized polyclonal antibody that is commonly used in life sciences research. It is also available as a monoclonal antibody for more specific applications. This antibody plays a crucial role in DNA repair and recombination processes by binding to the RAD51 protein, which is involved in homologous recombination. The RAD51A antibody can be used in various techniques, such as immunofluorescence, immunohistochemistry, and western blotting, to study the expression and localization of RAD51A in different cell types and tissues. It is often conjugated with colloidal gold or fluorescent dyes like fluorescein isothiocyanate (FITC) for easy detection. The RAD51A antibody has high affinity and specificity for its target antigen, allowing for accurate quantitation and neutralizing activity against the RAD51 protein. Researchers rely on this antibody to gain insights into DNA repair mechanisms, cancer biology, and other areas of scientific interest.
MMP2 antibody
The MMP2 antibody is a highly specialized polyclonal antibody that targets the matrix metalloproteinase 2 (MMP2) protein. This antibody is widely used in life sciences research to study the role of MMP2 in various biological processes. MMP2 is a key enzyme involved in the degradation of extracellular matrix components, and its dysregulation has been implicated in several diseases, including cancer, cardiovascular diseases, and inflammatory disorders.
CEA antibody
The CEA antibody is a monoclonal antibody that targets the carcinoembryonic antigen (CEA), a protein that is overexpressed in certain types of cancer cells. This antibody specifically binds to CEA and can be used for various applications in the field of Life Sciences. It has been widely used in research studies to detect CEA expression in tumor tissues and monitor its levels in patient samples.
CUGBP2 antibody
CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP
SIGLEC9 antibody
The SIGLEC9 antibody is a polyclonal antibody that specifically targets SIGLEC9, a glycoprotein that plays a crucial role in various biological processes. This antibody is produced using glycine and disulfide bond technology, resulting in high-quality antibodies with excellent specificity and sensitivity. It can be used in various applications in the field of life sciences, such as immunohistochemistry, flow cytometry, and Western blotting.
CHST1 antibody
CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL
Protein C antibody (HRP)
Protein C antibody (HRP) was raised in sheep using human Protein C purified from plasma as the immunogen.
HSPA9 antibody
The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.
SYT1 antibody
The SYT1 antibody is a highly effective polyclonal antibody that targets angptl3, a glycoprotein involved in various biological processes. This antibody can be used in chromatographic techniques for protein purification and immobilization, making it an essential tool in life sciences research. Additionally, the SYT1 antibody has neutralizing properties against inhibitors of growth factors, such as collagen, making it a valuable asset in cytotoxic studies. Whether you're conducting experiments or developing therapeutic strategies, the SYT1 antibody is a reliable choice for your research needs.
VAV1 antibody
The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.
LBP antibody
The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.
Endoglin antibody
Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ
Cytokeratin 10 antibody
Cytokeratin 10 antibody is a monoclonal antibody that specifically targets and binds to cytokeratin 10, a protein found in epithelial cells. This antibody is commonly used in life sciences research to study the expression and localization of cytokeratin 10 in various tissues and cell types. Cytokeratin 10 plays a crucial role in maintaining the structural integrity of epithelial cells and is involved in cell adhesion, migration, and differentiation processes. By targeting cytokeratin 10, this antibody enables researchers to gain valuable insights into the cellular mechanisms underlying tissue development, wound healing, and diseases such as cancer. With its high specificity and sensitivity, the cytokeratin 10 antibody is an essential tool for scientists investigating the complex functions of epithelial cells in both normal and pathological conditions.
VEGFD antibody
The VEGFD antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitor against TGF-β1 and chemokine, making it an essential component in various research studies. This monoclonal antibody has shown inhibitory properties against protein kinase, insulin, and natriuretic factors. Its unique design allows for precise targeting and binding to specific molecules, ensuring accurate results in immunoassays. With its ability to neutralize interferon activity, the VEGFD antibody opens up new possibilities for studying neurotrophic factors and their role in different biological processes. Researchers can rely on this high-quality antibody to enhance their experiments and gain valuable insights into cellular mechanisms.
Cox2 antibody
The Cox2 antibody is a growth factor that targets a specific cell antigen known as endothelial growth. It belongs to the category of polyclonal antibodies and is widely used in the field of Life Sciences. This antibody has been shown to have interactions with various proteins, including fibrinogen, lipoprotein lipase, and amyloid plaque. Additionally, it can inhibit the activity of lipase and phosphatase enzymes. The Cox2 antibody is available in both polyclonal and monoclonal forms, making it suitable for different research purposes. It is often used to detect autoantibodies or as a tool for studying triglyceride lipase activity. With its versatile applications, this antibody is an essential tool for researchers in various fields.
CCL11 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.
APLP2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp techniques, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Complement C5 antibody
Complement C5 antibody was raised in mouse using human complement component C5 as the immunogen.
CHCHD6 antibody
CHCHD6 antibody was raised in rabbit using the middle region of CHCHD6 as the immunogen
CX40.1 antibody
CX40.1 antibody was raised using the C terminal of CX40.1 corresponding to a region with amino acids QPRGRPHREAAQDPRGSGSEEQPSAAPSRLAAPPSCSSLQPPDPPASSSG
C5 antibody
The C5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the glucose transporter on actin filaments. This antibody has been extensively studied and proven to be highly effective in various applications.
Arginase I antibody
The Arginase I antibody is a highly effective monoclonal antibody that targets the protein complex responsible for the breakdown of arginine. It has been shown to have excellent colloidal properties, making it ideal for use in various applications. This antibody specifically binds to extracellular polysaccharides and can be used in both research and diagnostic settings.
MEK1 antibody
The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.
TRAPPC6B antibody
TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
GSTP1 antibody
GSTP1 antibody was raised in Mouse using a purified recombinant fragment of human GSTP1 expressed in E. coli as the immunogen.
