Anticorps primaires

The Cofilin antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It works by targeting and neutralizing chemokines, interferons, and growth factors that are activated and reactive in the body. This antibody has been shown to inhibit the activity of 3-kinase enzymes, which play a crucial role in cell growth and proliferation. Additionally, it can also bind to autoantibodies and taxol, preventing their harmful effects on the body. The Cofilin antibody has been extensively studied for its potential therapeutic applications in various diseases and conditions.

CHRM3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Mouse monoclonal RNF113B antibody

CD51 antibody (PE) was raised in mouse using human CD51 as the immunogen.

WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS

Insulin antibody is a highly specialized product used in Life Sciences research. It is an activated polyclonal antibody that specifically targets insulin. This antibody is widely used in immunohistochemistry studies to detect and visualize insulin expression in tissues. It has also been shown to have neutralizing activity against insulin, making it a valuable tool for studying the role of insulin in various biological processes.

ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit polyclonal PKC pan antibody (Thr497)

KC antibody was raised in rabbit using highly pure recombinant murine KC as the immunogen.

PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.

ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTRKLEDHCFYHGTVRET

The KRT19 antibody is a highly effective neutralizing agent used in Life Sciences. It is designed to target specific epitopes and bind to the desired antigens with high affinity. This antibody is produced using state-of-the-art technology and undergoes rigorous quality control measures to ensure its effectiveness.

Rabbit polyclonal ZNF774 antibody

The PKR1 antibody is a highly specialized chemokine that is activated in various Life Sciences applications. This antibody has been extensively studied and proven to be effective in targeting fatty acids and growth factors. It is a monoclonal antibody that specifically targets the PKR1 receptor, which plays a crucial role in cell signaling pathways. The PKR1 antibody has shown remarkable results in inhibiting the growth of cancer cells, including MCF-7 breast cancer cells, by blocking the epidermal growth factor receptor pathway. Additionally, it has been used as an anti-CD33 antibody to target leukemia cells and as a mesenchymal stem cell inhibitor for research purposes. With its potent activity and specificity, the PKR1 antibody is a valuable tool for researchers working in the field of molecular biology and drug discovery.

ITGA5 antibody was raised in Rabbit using Human ITGA5 as the immunogen

PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ

Rabbit polyclonal TRPC4AP antibody

PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ

LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL

Goat anti-mouse IgM (biotin) was raised in goat using murine IgM heavy chain as the immunogen.

MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII

Complement C2 antibody was raised using the N terminal of C2 corresponding to a region with amino acids EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS

Rabbit polyclonal SDF2L1 antibody

The Caveolin 1 antibody is a highly specialized monoclonal antibody that targets tyrosine residues on the Caveolin 1 protein. This protein plays a crucial role in cellular processes such as growth factor signaling and receptor internalization. By binding to Caveolin 1, this antibody inhibits its function, leading to cytotoxic effects on cancer cells.

Goat anti-Guinea Pig IgG (H + L) was raised in goat using purified Guinea Pig IgG (H&L) as the immunogen.

Armenian Hamster monoclonal CD3 antibody (PE)

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. The effectiveness of this drug has been demonstrated through transcription-quantitative polymerase chain reactions, as well as patch-clamp techniques on human erythrocytes. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.

CXADR antibody was raised in Rabbit using Human CXADR as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing the growth of bacteria. Its efficacy has been demonstrated through extensive studies using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.

CD105 antibody was raised in rabbit using recombinant human soluble CD105/Endoglin as the immunogen.

Strongzyme Goat anti Rabbit IgG (H + L) secondary antibody (HRP)

Rabbit anti-sheep IgG (Rhodamine) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.

Rabbit anti-human patelet-activating factor acetylhydrolase(Lp-PLA2)  polyclonal Antibody

The MOR antibody is a monoclonal antibody that specifically targets the mu-opioid receptor (MOR). This receptor plays a crucial role in mediating the effects of opioids and is involved in pain management and addiction. The MOR antibody has high affinity and specificity for the MOR, making it an excellent tool for studying opioid signaling pathways and developing new therapeutic strategies.

POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(c) whole molecule as the immunogen.

Lipoprotein Lipase Monoclonal Antibody Biotin

Purified Polyclonal ADRB2 antibody

MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.

Rabbit polyclonal COMMD4 antibody

Goat anti-syrian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

Rabbit polyclonal SLC25A6 antibody

ZNF660 antibody was raised in rabbit using the C terminal of ZNF660 as the immunogen

The COL4A5 antibody is a monoclonal antibody that specifically targets the collagen type IV alpha 5 chain. It can be used in various applications in Life Sciences research. This antibody has been shown to bind to collagen type IV and inhibit its activity, making it a valuable tool for studying the role of collagen in various cellular processes. Additionally, the COL4A5 antibody has been used in experiments involving creatine kinase activation and family kinase inhibition. Its efficacy has also been demonstrated in electrode-based assays. This antibody is highly specific and shows minimal cross-reactivity with other proteins. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the most suitable option for their experiments. The COL4A5 antibody is an essential tool for investigating the functions and mechanisms of collagen type IV and its associated pathways.

KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL

LDL receptor antibody (biotin) was raised in rabbit using a specific synthetic peptide (sequence not conserved in VLDL receptor and LRP) of the LDL receptor extracellular domain as the immunogen.

ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV

The Midkine antibody is a powerful tool in Life Sciences research. Midkine is a growth factor that plays a crucial role in various biological processes, including cell proliferation, migration, and survival. It interacts with TGF-β1 and other binding proteins to regulate the activity of the erythropoietin receptor.

GSTM4 antibody was raised in Rabbit using Human GSTM4 as the immunogen

Drebrin antibody was raised in guinea pig using a synthetic human peptide corresponding to residues 324-343 of drebrin coupled to KLH as the immunogen.

The RFX2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to insulin, making it an essential tool for studying insulin-related processes. This antibody recognizes the tyrosine residues on insulin molecules, allowing for precise detection and analysis.

Sheep polyclonal Ritodrine antibody

Rabbit polyclonal RPL17 antibody (FITC)

Rabbit polyclonal URM1 antibody

Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.

SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN

The ACADL antibody is a neurotrophic factor monoclonal antibody that has shown promising results in various studies. This antibody acts as a growth factor and has the ability to promote cell survival and differentiation. It can be used in research settings to study the effects of neurotrophic factors on neuronal development and function.

MPP7 antibody was raised in Rabbit using Human MPP7 as the immunogen

The IL15Ra antibody is a highly specialized antibody used in Life Sciences research. It targets the IL-15 receptor alpha chain, which plays a crucial role in immune response and cell proliferation. This antibody is commonly used in studies involving colony-stimulating factors and macrophage colony-stimulating factors.

PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Mouse monoclonal ZIM2 antibody

Rat monoclonal CD144 antibody (PE)

Affinity purified Rabbit polyclonal MDH2 antibody