Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
BECN1 antibody
The BECN1 antibody is a monoclonal antibody that has been specifically designed to target and bind to the BECN1 protein. This protein plays a crucial role in autophagy, which is the process by which cells break down and recycle their own components. By binding to BECN1, this antibody activates the autophagy pathway, leading to increased cell survival and improved cellular function.
AKAP10 antibody
AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ
CD19 antibody (Spectral Red)
CD19 antibody (Spectral Red) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molPAK1 antibody
The PAK1 antibody is a highly specific antibody used in the field of Life Sciences. It is capable of recognizing and binding to the amino-terminal and carboxyl terminal regions of PAK1, a protein involved in various cellular processes. This antibody can be utilized for a wide range of applications, including immunoassays, Western blotting, immunohistochemistry, and more.
Streptococcus Group B antibody (biotin)
Streptococcus group B antibody (biotin) was raised in rabbit using group B Streptococci as the immunogen.SDHB antibody
The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.
Villin antibody
The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.
Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
IL13RA2 antibody
IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
AQP8 antibody
The AQP8 antibody is a diagnostic agent used in Life Sciences for the detection of protein-protein interactions. It is reactive towards sorafenib and has been shown to specifically bind to chemokine receptors. This monoclonal antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The AQP8 antibody is also capable of detecting autoantibodies and can be used to study the role of specific proteins in disease pathology. It recognizes specific epitopes on AQP8, which is an aquaporin protein involved in the transport of water and glycerol across cell membranes. With its high specificity and sensitivity, this polyclonal antibody is an essential tool for researchers in the field of Life Sciences.
IL10 antibody
The IL10 antibody is a powerful tool in the field of Life Sciences. It specifically targets and neutralizes Interleukin-10 (IL-10), a cytokine that plays a crucial role in immune regulation and inflammation. By binding to IL-10, this antibody inhibits its cytotoxic effects and prevents it from interacting with its receptors.
CD30 antibody (biotin)
CD30 antibody (biotin) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molCLP1 antibody
The CLP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is an anti-HER2 antibody that specifically targets the epidermal growth factor receptor HER2, which is overexpressed in certain types of cancer cells. The CLP1 antibody has been extensively studied and shown to have cytotoxic effects on cancer cells, making it a promising candidate for targeted therapies.
NQO1 antibody
The NQO1 antibody is a highly specific monoclonal antibody that targets the alpha-fetoprotein. It is widely used in Life Sciences research for various applications. This antibody binds to the vasoactive intestinal peptide (VIP) and can be used as an electrode for studying VIP receptors. Additionally, it has been shown to have colony-stimulating factor activity and can activate colony-stimulating cells. The NQO1 antibody also exhibits acidic phosphatase activity and is commonly used in assays to detect this enzyme in human serum samples. Furthermore, it has been found to modulate the production of interferon-gamma (IFN-gamma), a key cytokine involved in immune responses. With its wide range of applications, the NQO1 antibody is an essential tool for researchers in the field of Life Sciences.
RANKL antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive human activity studies using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains, such as ESX-1 secretion system protein, effectively inhibiting cell growth in culture.
Endostatin antibody
Endostatin antibody was raised in Mouse using recombinant endostatin as the immunogen.Degré de pureté :≥85% By Sds-PageCD26 antibody (biotin)
CD26 antibody (biotin) was raised in mouse using human T cell clone as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molBIRC5 antibody
The BIRC5 antibody is a monoclonal antibody that targets the growth factor known as neurotrophic factors. It acts as a neuroprotective agent by inhibiting the activity of phosphatase enzymes, which play a critical role in cell survival and growth. This antibody has shown promising results in studies involving sphingosine-induced neuronal death and pancreatic glucagon secretion. The BIRC5 antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods. It can be used in various applications within the Life Sciences field, including research, diagnostics, and therapeutic development. This highly specific antibody is suitable for use in immunoassays, such as ELISA or Western blotting, to detect the presence of BIRC5 in samples such as blood plasma or tissue lysates. Its high affinity binding to BIRC5 makes it an ideal tool for studying cellular processes regulated by this growth factor.
GPR171 antibody
The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.
CPA1 antibody
The CPA1 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a protein involved in inflammatory responses. This antibody has shown efficacy in blocking the activity of TNF-α, which plays a crucial role in various diseases and conditions. Studies have also demonstrated that the CPA1 antibody can inhibit the production of interleukin-6 and interferon, both of which are involved in immune responses. Additionally, this monoclonal antibody has been shown to bind to transferrin, a biomolecule involved in iron transport, as well as nuclear receptors. The CPA1 antibody holds promise for therapeutic applications due to its ability to target specific proteins and disrupt protein complexes involved in disease pathogenesis.
Keratin K16 antibody
Keratin K16 antibody was raised in Guinea Pig using synthetic peptide of human keratin K16 coupled to KLH as the immunogen.
Degré de pureté :Min. 95%ADARB1 antibody
ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
V5 Tag antibody
The V5 Tag antibody is a monoclonal antibody used in Life Sciences research. It specifically binds to the V5 epitope, a small peptide sequence that is commonly fused to target proteins for detection and purification purposes. This antibody is widely used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.
Cathepsin F antibody
The Cathepsin F antibody is a polyclonal antibody that specifically targets and binds to Cathepsin F, an acidic cysteine protease. Cathepsin F plays a crucial role in various physiological processes, including the degradation of extracellular matrix components such as fibronectin and collagen. This antibody is highly specific and can be used in various life science applications, including immunohistochemistry, Western blotting, and ELISA.
SRY antibody
The SRY antibody is a highly specialized growth factor that has been extensively studied in the field of Life Sciences. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and development. The SRY antibody has been shown to have a neutralizing effect on interferon-gamma (IFN-gamma), which is an important cytokine involved in immune responses.Chlamydia trachomatis antibody
Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis LPS as the immunogen.Factor VIII antibody (HRP)
Factor VIII antibody (HRP) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.
CFTR antibody
CFTR antibody is an antibody that specifically targets the cystic fibrosis transmembrane conductance regulator (CFTR) protein. CFTR is involved in the transport of chloride ions across cell membranes, and mutations in this protein can lead to cystic fibrosis. This antibody can be used in various Life Sciences applications, such as immunohistochemistry and Western blotting, to study the expression and localization of CFTR. It has been shown to bind to CFTR with high specificity and sensitivity. Additionally, this antibody has been used to investigate the role of CFTR in various biological processes, including collagen synthesis, hyaluronidase activity, and microvessel density regulation. Its ability to detect glycoproteins and growth factors makes it a valuable tool for studying cellular signaling pathways involving CFTR.
Troponin T Type 2 antibody
Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE
A2M antibody
The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.
Degré de pureté :Min. 95%Atrazine antibody
The Atrazine antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets atrazine, a commonly used herbicide. This antibody can be used in various research applications, particularly in studies involving mesenchymal stem cells and microvessel density.
H2AFX antibody
H2AFX antibody was raised using the middle region of H2AFX corresponding to a region with amino acids ELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQE
PPAR alpha antibody
PPAR Alpha antibody was raised in rabbit using a synthetic peptide corresponding to residues M(1) V D T E S P I C P L S P L E A D D(18) C of mouse PPAR alpha.Degré de pureté :Min. 95%PSMB6 antibody
PSMB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA
OLIG2 antibody
The OLIG2 antibody is a highly specific and sensitive tool used in various research applications in the field of Life Sciences. This polyclonal antibody is designed to target OLIG2, a transcription factor that plays a crucial role in the development of the central nervous system.
Ubiquilin 3 antibody
Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE
PNPLA3 antibody
PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
GALNT7 antibody
The GALNT7 antibody is a highly specific polyclonal antibody that targets GALNT7, an enzyme responsible for adding sugar molecules to proteins. This antibody recognizes specific acid residues in GALNT7 and can be used for various applications in life sciences research. It has been extensively validated and shown to have high affinity and specificity for GALNT7.
PIB5PA antibody
PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%VWF antibody (HRP)
VWF antibody (HRP) was raised in goat using human vWF purified from plasma as the immunogen.
DDB1 antibody
The DDB1 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to DDB1, a protein involved in various cellular processes. This antibody is commonly used in hybridization experiments and immunohistochemistry studies to detect the presence and localization of DDB1 in different tissues and cell types. The DDB1 antibody has also been shown to have cytotoxic effects on human hepatocytes, making it a valuable tool for studying the role of DDB1 in liver diseases. Additionally, this antibody can be used in combination with other antibodies or growth factors to investigate the interactions between DDB1 and other proteins or signaling pathways. Whether you are conducting basic research or developing new therapeutic strategies, the DDB1 antibody is an essential tool for understanding the functions of this important protein.
ENO2 antibody
The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.
alpha Synuclein antibody
The alpha Synuclein antibody is a powerful tool in the field of Life Sciences. It specifically targets alpha-synuclein, a protein that plays a crucial role in neurodegenerative disorders such as Parkinson's disease. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.
TIE2 antibody
The TIE2 antibody is a monoclonal antibody that targets the growth factor receptor TIE2. This receptor plays a crucial role in regulating angiogenesis and vascular endothelial cell function. By binding to TIE2, the antibody blocks the activation of downstream signaling pathways, inhibiting tumor growth and metastasis.
