Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
NOTCH1 antibody
The NOTCH1 antibody is a monoclonal antibody that specifically targets the NOTCH1 protein. It is commonly used in various assays and research studies in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.
VSV-G antibody
VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%CCNA2 antibody
CCNA2 antibody was raised in rabbit using the C terminal of CCNA2 as the immunogenDegré de pureté :Min. 95%CD45 antibody
CD45 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%pan Cytokeratin antibody
pan Cytokeratin antibody was raised in Mouse using a purified recombinant fragment of Cytokeratin 5 expressed in E. coli as the immunogen.CD137L antibody
CD137L antibody was raised in rabbit using highly pure recombinant human 4-1BBL as the immunogen.
ORM2 antibody
The ORM2 antibody is a highly specialized monoclonal antibody that is used in various applications within the field of life sciences. This antibody specifically targets and reacts with the ORM2 protein, which is found in blood plasma and plays a crucial role in transporting fatty acids. The ORM2 antibody can be used in assays such as double-label immunofluorescence to detect the presence and localization of ORM2 protein in different cell types or tissues. It has also been utilized in studies involving pluripotent stem cells, where it helps identify specific markers such as neuronspecific enolase. With its high specificity and affinity, the ORM2 antibody provides researchers with a valuable tool for investigating the functions and interactions of this important protein.
RTN4IP1 antibody
RTN4IP1 antibody was raised in rabbit using the middle region of RTN4IP1 as the immunogen
BCOR antibody
The BCOR antibody is a monoclonal antibody that specifically targets the necrosis factor-related apoptosis-inducing protein. This antibody has been widely used in Life Sciences research to study various biological processes, including amyloid plaque formation and cell death pathways. The BCOR antibody exhibits high specificity and affinity for its target and has been extensively characterized for its binding properties. It is also serum albumin-binding, which allows for efficient delivery and distribution in vivo. This antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. Whether you are studying erythropoietin signaling or investigating growth factors involved in low-density lipoprotein metabolism, the BCOR antibody is an invaluable tool for your research needs. Choose this highly reliable and validated monoclonal antibody to ensure accurate and reproducible results in your experiments.
RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Degré de pureté :Min. 95%ELK1 antibody
The ELK1 antibody is a highly specific polyclonal antibody that targets the subtilisin/kexin type of enzymes. It is capable of recognizing and binding to the activated form of ELK1, a transcription factor involved in hepatocyte growth. This monoclonal antibody has been extensively used in various life sciences research applications, particularly in the study of mesenchymal stem cells.
EGF antibody
The EGF antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF), a key regulator of cell growth and division. This antibody has been extensively studied and proven to be highly effective in inhibiting the activity of EGF and its downstream signaling pathways.
Goat anti Monkey IgM (Texas Red)
Goat anti-monkey IgM was raised in goat using monkey IgM mu heavy chain as the immunogen.Degré de pureté :Min. 95%SHP2 antibody
The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.
Degré de pureté :Min. 95%PDIA4 antibody
The PDIA4 antibody is a powerful tool in the field of Life Sciences. It is designed to target and detect PDIA4, a protein that plays a crucial role in various cellular processes. PDIA4 is involved in oxidative damage repair, actin dynamics, autoantibody production, and the regulation of growth factors such as erythropoietin and epidermal growth factor.
SF1 antibody
SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ
Adenosine Deaminase antibody
The Adenosine Deaminase antibody is a highly specialized biomolecule used in Life Sciences research. It is available as both a monoclonal and polyclonal antibody, making it versatile for various applications. This antibody specifically targets and binds to adenosine deaminase, an enzyme involved in the breakdown of adenosine.
TP53 antibody
The TP53 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes epidermal growth factor (EGF)-like growth factor, which plays a crucial role in cell proliferation and survival. This antibody is designed to bind with high affinity to EGF-like growth factors, preventing their interaction with receptors on the surface of cells.
Goat anti Rat IgG (H + L) (Fab'2) (FITC)
Goat anti-rat IgG (H+L) (Fab'2) (FITC) was raised in goat using rat IgG whole molecule as the immunogen.
Degré de pureté :Min. 95%GPR4 antibody
The GPR4 antibody is a retinoid and HDAC inhibitor that belongs to the class of monoclonal antibodies. It is used in vaccine strains and has been shown to target β-catenin, collagen, and methyl transferase. This antibody is widely used in the field of life sciences and medicine for its nuclear properties. The GPR4 antibody specifically binds to Gynura procumbens and can be used as a tool for studying various cellular processes. With its high specificity and affinity, this antibody is a valuable tool for researchers in the field of antibodies.
S100A9 antibody
S100A9 antibody was raised using the N terminal of S100A9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKDegré de pureté :Min. 95%ZNF624 antibody
ZNF624 antibody was raised in rabbit using the middle region of ZNF624 as the immunogen
Degré de pureté :Min. 95%RAB3D antibody
The RAB3D antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the alpha-fetoprotein (AFP) in human serum. Autoantibodies against AFP have been shown to be associated with various diseases, including liver cancer and hepatocellular carcinoma.
Complement factor H antibody
The Complement factor H antibody is a highly specialized antibody that plays a crucial role in the regulation of the immune system. It binds to glutamate and other molecules to prevent excessive activation of the complement system, which can lead to inflammation and tissue damage. This antibody is widely used in life sciences research, particularly in studies related to insulin, lipoprotein lipase, and heparin-induced thrombocytopenia. It is also used as a diagnostic tool for detecting insulin antibodies and as a therapeutic agent for targeting growth factors such as trastuzumab and epidermal growth factor. With its high specificity and affinity for its target molecules, this monoclonal antibody is an essential component in many medicaments and has proven to be invaluable in various research applications.
Tie2 antibody
The Tie2 antibody is a highly specialized monoclonal antibody that targets the carboxyl terminus of the Tie2 receptor. It is commonly used in Life Sciences research to study the role of Tie2 in various biological processes. This antibody specifically binds to human hepatocytes and has been shown to inhibit elastase activity, which is crucial for maintaining tissue integrity. The Tie2 antibody is produced using state-of-the-art hybridization techniques and purified using bovine γ-globulin and streptavidin. Its high specificity and low viscosity make it an ideal tool for studying the natriuretic properties of Tie2 and its potential therapeutic applications.
CD3e antibody (Spectral Red)
CD3e antibody (Spectral Red) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.
Degré de pureté :Min. 95%ZFP91 antibody
ZFP91 antibody was raised in rabbit using the N terminal of ZFP91 as the immunogen
Degré de pureté :Min. 95%Vav antibody
The Vav antibody is a polyclonal antibody that specifically targets the Vav protein. This antibody is widely used in life sciences research to study the role of Vav in various cellular processes. The Vav protein is involved in signal transduction pathways, particularly those mediated by TGF-beta and growth factors. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis.
Degré de pureté :Min. 95%HIV1 tat antibody
HIV1 tat antibody was raised in mouse using HIV-1 tat epitope mapped to N-terminus of HIV -1 tat as the immunogen.p0071 antibody
p0071 antibody was raised in mouse using synthetic peptide of human Plakophilin 4 as the immunogen.AKT3 antibody
The AKT3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the c-myc protein, which is involved in cell growth and proliferation. This antibody has a high affinity for its target and can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.Neurochondrin antibody
Neurochondrin antibody was raised using the N terminal of NCDN corresponding to a region with amino acids MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS
USP4 antibody
USP4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%IL6 antibody
IL6 antibody was raised in goat using highly pure recombinant human IL-6 as the immunogen.
PRAME antibody
PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
DDX49 antibody
DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR
PDGFRB antibody
PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%TTF1 antibody
TTF1 antibody was raised in mouse using Rat TTF-1 recombinant protein as the immunogen.
STK11 antibody
STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
SLC12A2 antibody
SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
CRYAB antibody
The CRYAB antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the CRYAB protein, also known as alpha-crystallin B chain. This protein plays a crucial role in various cellular processes, including cytoprotection, chaperone activity, and regulation of apoptosis.
