Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
RPE antibody
RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
FARS2 antibody
FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
CtBP2 antibody
The CtBP2 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that specifically detects CtBP2, a protein involved in various cellular processes. This antibody has been extensively validated and shown to have high affinity and specificity for its target.
CDY1 antibody
CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
p53 antibody
The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.
Endomucin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. In addition, it has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
HIV1 p24 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.
Histamine H4 Receptor antibody
The Histamine H4 Receptor antibody is a powerful tool for researchers in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing options for different experimental needs.
SCG3 antibody
The SCG3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB), which is a transcription factor involved in various cellular processes. The SCG3 antibody has been shown to inhibit the polymerase activity of NF-κB, leading to a decrease in gene expression of acidic proteins. This antibody can be used in immunoassays to detect and quantify NF-κB activation. Additionally, the SCG3 antibody has proteolytic activity and has been shown to cleave caspase-9, an endonuclease involved in apoptosis. Its immobilization on surfaces allows for easy and efficient use in various experimental settings, making it a valuable tool for researchers studying NF-κB signaling pathways and related cellular processes.
Legionella pneumophila antibody (HRP)
Legionella pneumophila antibody (HRP) was raised in rabbit using a whole cell preparation of Legionella pneumophila; ATCC #33152 as the immunogen.IL6 antibody
IL6 antibody is a highly effective therapeutic agent that targets interleukin-6 (IL-6), a key cytokine involved in inflammatory responses. IL-6 plays a crucial role in various physiological processes, including immune response and inflammation. This antibody specifically binds to IL-6, preventing its interaction with its receptors and inhibiting downstream signaling pathways.
CD32 antibody (Fab 2)
CD32 antibody (Fab'2) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.
GBA antibody
The GBA antibody is a polyclonal antibody that specifically targets the primary amino acid sequence of the glucocerebrosidase (GBA) enzyme. This antibody is derived from human serum and has been extensively validated for its specificity and sensitivity. It can be used in various applications, including enzyme-linked immunosorbent assays (ELISAs), Western blotting, and immunohistochemistry.
FZD6 antibody
The FZD6 antibody is a powerful diagnostic agent and inhibitor that belongs to the class of polyclonal antibodies. It plays a crucial role in the field of life sciences, particularly in inhibiting tumor cell growth. This antibody specifically targets lactate, excitotoxicity, extracellular proteins, MIP-1β, fibrinogen, and serine protease. Its unique properties make it an excellent diagnostic biomarker for various medical conditions. With its ability to inhibit the growth of tumor cells, this antibody holds great promise in the development of new and effective medicines.
SYN1 antibody
The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.
Aminoacylase 1 antibody
The Aminoacylase 1 antibody is a highly active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody has been shown to activate oxygen uptake and is commonly used in the field of medicine. It serves as a serum marker and is particularly effective in high-flux assays. The Aminoacylase 1 antibody can also be used in conjunction with other antibodies such as anti-mesothelin or interferon-stimulated gene antibodies. Additionally, it has been found to have methyl transferase properties. With its wide range of applications, this antibody is an invaluable tool for researchers in various scientific disciplines.
Spermidine synthase antibody
The Spermidine synthase antibody is a monoclonal antibody that specifically targets the tyrosine residue in interleukin-6 (IL-6). It is a highly specific and sensitive tool used in Life Sciences research to detect and quantify IL-6 levels in various biological samples. This antibody has been extensively validated for its specificity, sensitivity, and reproducibility.
IL4 antibody
The IL4 antibody is a pegylated monoclonal antibody that is used in the field of Life Sciences as a medicament. It has been extensively studied for its glycation properties, particularly in human serum. The IL4 antibody can be immobilized onto a carbon electrode and used in electrochemical detection methods. It has also been used in conjunction with adeno-associated viruses to deliver therapeutic antibodies directly to specific cells or tissues. Additionally, the IL4 antibody has been shown to bind to actin filaments and can be labeled with phalloidin for visualization purposes. With its wide range of applications and specificity, the IL4 antibody is a valuable tool in various research fields.
MST4 antibody
The MST4 antibody is a polyclonal antibody that specifically targets and binds to the triglyceride lipase known as MST4. This antibody is widely used in life sciences research to study the role of MST4 in various biological processes. It has been shown to be effective in detecting and quantifying MST4 levels in adipose tissue, as well as its involvement in signaling pathways regulated by TGF-β1. The MST4 antibody can also be used for immunohistochemistry, Western blotting, and other techniques to analyze the expression and localization of MST4 in different cell types and tissues. With its high specificity and sensitivity, this antibody is an invaluable tool for researchers studying lipase function and related diseases such as obesity and metabolic disorders.
HTR1A antibody
The HTR1A antibody is a highly valuable product in the field of Life Sciences. It plays a crucial role as a heparin cofactor and is used in various medical applications, including as an inhibitor for certain medications. Additionally, this antibody has been found to have significant effects on fetal hemoglobin and autoantibodies.
Homer antibody
The Homer antibody is a growth factor that is commonly found in human serum. It is widely used in Life Sciences research and has been shown to have neutralizing effects on various nuclear factors. The antibody can be used for both in vitro and in vivo experiments, making it a versatile tool for researchers. It is available as both monoclonal and polyclonal antibodies, allowing for flexibility in experimental design. The Homer antibody has been extensively studied for its role in inhibiting the activity of mesothelin, a protein involved in cancer progression. Additionally, it has shown potential as an inhibitor of fibrinogen, collagen, and alpha-fetoprotein. Its antiviral properties make it a valuable asset in the field of virology research. With its wide range of applications and proven efficacy, the Homer antibody is a must-have for any researcher looking to advance their scientific understanding.
SLC5A4 antibody
SLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of Ibuprofen, a nonsteroidal anti-inflammatory drug (NSAID). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The antibody specifically binds to Ibuprofen, leading to its neutralization and preventing it from exerting its anti-inflammatory effects.
PCBP2 antibody
The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.
Nkx2.5 antibody
The Nkx2.5 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets the Nkx2.5 protein, which plays a crucial role in heart development and function. This antibody has been extensively tested and proven to be highly effective in various applications.
CHK2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by inhibiting DNA-dependent RNA polymerase, which hinders transcription and replication processes essential for bacterial survival. The effectiveness of this drug has been confirmed through extensive testing using advanced techniques such as patch-clamp on human erythrocytes. Additionally, its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively impedes their growth in culture.
alpha 2 Antiplasmin antibody
alpha 2 Antiplasmin antibody was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.
Fibronectin antibody
The Fibronectin antibody is an antigen binding molecule that specifically targets fibronectin, a protein involved in cell adhesion and migration. It has been shown to inhibit the activation of tyrosine kinase receptors and block the binding of fibronectin to its receptors on cells. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the biological effects of fibronectin in different tissues and cell types.
COX4 antibody
The COX4 antibody is a highly specialized antibody that targets the COX4 protein. This protein plays a crucial role in various biological processes, including energy production and cellular respiration. The COX4 antibody is widely used in life sciences research to study the function and regulation of this important protein.
CA11 antibody
The CA11 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to a polypeptide expressed in various biological systems. This antibody can be used for the detection and quantification of the target protein in samples, making it an essential tool for researchers studying protein expression and function. Additionally, the CA11 antibody can be used in applications such as immunohistochemistry, Western blotting, and ELISA assays. Its high specificity and sensitivity make it a valuable asset in the field of Life Sciences. Whether you are working with recombinant antigens, collagen, interferon, protein kinases, arginase inhibitors, or even food extracts and industrial samples, the CA11 antibody is an excellent choice for your research needs. With its ability to recognize both monoclonal and polyclonal antibodies, this versatile tool is sure to enhance your experimental outcomes. Trust the CA11 antibody to provide accurate results and reliable performance in your scientific endeavors.
MUC13 antibody
The MUC13 antibody is a highly specialized antibody that targets the tyrosine-rich region of the MUC13 protein. It is commonly used in Life Sciences research to study multidrug resistance, glycation processes, and the role of MUC13 in various cellular pathways. This antibody has been shown to interact with key proteins such as E-cadherin, circumsporozoite protein, nuclear β-catenin, and growth factors. Additionally, it has demonstrated cytotoxic activity against specific cell lines and has potential antiviral properties. The MUC13 antibody is available as both polyclonal and monoclonal antibodies, making it a versatile tool for researchers in various fields.
Tau antibody
The Tau antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to Tau proteins. Tau proteins play a crucial role in maintaining the structure and function of nerve cells in the brain. However, in certain neurodegenerative diseases such as Alzheimer's disease, these proteins become abnormally phosphorylated and form tangles, leading to cognitive decline.
