Anticorps primaires

Rabbit polyclonal ZNF436 antibody

TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL

The GATA4 antibody is a highly specific monoclonal antibody that is used in various applications within the field of Life Sciences. This cytotoxic antibody is designed to target and bind to GATA4, a transcription factor that plays a crucial role in the regulation of gene expression. By binding to GATA4, this antibody can modulate its activity and potentially inhibit its function.

Rabbit polyclonal BAI1 antibody

Mouse monoclonal CD3 antibody (PE)

The CD44 antibody is a powerful tool used in Life Sciences research. It belongs to the category of anti-ICOS antibodies and is widely used in various applications. This antibody specifically targets CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion, migration, and signaling.

NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV

Mouse monoclonal RNPEP antibody

ABCF2 antibody was raised in Rabbit using Human ABCF2 as the immunogen

The KLK7 antibody is a highly potent and specific monoclonal antibody that targets the KLK7 antigen. It has been widely used in Life Sciences research for its ability to detect and immobilize KLK7 in various applications. This antibody binds to KLK7 with high affinity, allowing for accurate and reliable detection of this protein. Additionally, the KLK7 antibody has been shown to have minimal cross-reactivity with other proteins, ensuring precise and specific results. It is commonly used in studies involving actin filaments, atypical hemolytic disorders, and nuclear localization of proteins. The KLK7 antibody is available in both purified and conjugated forms, making it versatile for a wide range of experimental needs. With its exceptional sensitivity and specificity, this antibody is an essential tool for researchers in the field of Life Sciences.

The Caspase 8 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It plays a crucial role in various biological processes, including natriuretic regulation, growth factor signaling, and medicament development. This antibody specifically targets caspase 8, an enzyme involved in cellular apoptosis.

Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.

Affinity purified Rabbit polyclonal Munc 13 4 antibody

BCL10 antibody was raised in Rabbit using Human BCL10 as the immunogen

Rabbit polyclonal CYP2A13 antibody

RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

Affinity purified Rabbit polyclonal GABPB1 antibody

PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI

TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE

CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.

TKTL1 antibody was raised using the middle region of TKTL1 corresponding to a region with amino acids QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA

The STAT3 antibody is a monoclonal antibody that specifically targets the cytokine family. It has been extensively studied and validated using mass spectroscopy techniques in Life Sciences research. This antibody is designed to detect activated STAT3 in nuclear extracts, making it an essential tool for studying signaling pathways involving this transcription factor. The STAT3 antibody has been used in various applications such as chromatin immunoprecipitation assays to investigate its DNA binding activity and its role in gene regulation. Additionally, this antibody has shown anti-thrombotic properties and has been implicated in oxygen therapy research. Whether you're conducting basic research or exploring therapeutic avenues, the STAT3 antibody is a valuable tool for your studies. Choose from our range of high-quality monoclonal and polyclonal antibodies to meet your specific research needs.

Mouse thrombocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymocytes as the immunogen.

The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.

The MC5R antibody is a highly specialized monoclonal antibody that binds to the MC5 receptor, a specific type of receptor found in various cells throughout the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.

Rabbit polyclonal MAP2K7 antibody (Ser271)

MAPK7 antibody was raised in Rabbit using Human MAPK7 as the immunogen

CIDEA antibody was raised in Rabbit using Human CIDEA as the immunogen

EFNA4 antibody was raised in rabbit using the N terminal of EFNA4 as the immunogen

Rat monoclonal CD19 antibody (FITC)

SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

GFPT2 antibody was raised in rabbit using the N terminal of GFPT2 as the immunogen

UBXN6 antibody was raised in rabbit using the C terminal of UBXN6 as the immunogen

The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.

Affinity purified Rabbit polyclonal Unc182 antibody

Rabbit polyclonal HNRPH1 antibody

Affinity purified Rabbit polyclonal PTPN11 antibody

Armenian Hamster monoclonal CD103 antibody (allophycocyanin)

The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.

Affinity purified Rabbit polyclonal Serpina 4 antibody

ARL8B antibody was raised in Rabbit using Human ARL8B as the immunogen

Affinity purified Rabbit polyclonal CD172 gamma antibody

CA8 antibody was raised in Rabbit using Human CA8 as the immunogen

MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE

The c-Jun antibody is a specific monoclonal antibody that targets the polymorphic protein known as c-Jun. This antibody is widely used in the field of life sciences for research purposes. It has been shown to effectively detect and bind to c-Jun, allowing for the study of its functions and interactions within cells.

Affinity purified Rabbit polyclonal STRA8 antibody

Rabbit polyclonal TNAP1 antibody

Affinity purified Rabbit polyclonal USP47 antibody

Affinity purified Rabbit polyclonal STMN2 antibody

FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS

The Syntaxin 5 antibody is a highly specialized neurotrophic factor that plays a crucial role in various biological processes. This antibody is designed to specifically target and bind to the Syntaxin 5 protein, which is involved in the regulation of chemokine activity and the activation of interferon and insulin signaling pathways.

Rabbit polyclonal ADCY7 antibody

The Lp-PLA2 monoclonal antibody is a powerful growth factor that targets specific proteins involved in the regulation of collagen and fatty acid metabolism. This antibody is designed to bind to Lp-PLA2, an enzyme responsible for the production of inflammatory mediators. By inhibiting this enzyme, the monoclonal antibody reduces inflammation and promotes healthy tissue repair.

DIDO1 antibody was raised in Rabbit using Human DIDO1 as the immunogen

Mouse monoclonal EPSP synthase antibody

APBB2 antibody was raised in Rabbit using Human APBB2 as the immunogen

Rabbit polyclonal RAP2A antibody

Cytokeratin 16 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD

The AQP4 antibody is a glycoprotein that plays a crucial role in the regulation of water balance in the body. It is an essential component of the cell membrane and facilitates the movement of water molecules across cell membranes. The AQP4 antibody is widely used in life sciences research, particularly in studies related to water transport and homeostasis.

CARD6 antibody was raised in Rabbit using Human CARD6 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like patch-clamp to determine its human activity. The metabolism of this drug involves various transformations such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth. With its potent properties, this drug offers a promising solution for combating tuberculosis.

The Caspase 1 antibody is a highly effective tool for immunoassays and research purposes. This antibody specifically targets caspase 1, a key enzyme involved in inflammatory responses and cell death. It has been shown to neutralize the activity of caspase 1, making it an essential component for studies related to fibronectin, insulin, collagen, β-catenin, and other growth factors.

ARL3 antibody was raised in rabbit using the N terminal of ARL3 as the immunogen

The YTHDF1 antibody is a highly specialized monoclonal antibody that targets the YTH domain family protein 1 (YTHDF1). This peptide system plays a crucial role in various biological processes, including RNA metabolism and translation regulation. The YTHDF1 antibody is designed to specifically bind to YTHDF1 and neutralize its activity.

GYG2 antibody was raised in Rabbit using Human GYG2 as the immunogen

Donkey anti-mouse IgG (H + L) (FITC) was raised in donkey using mouse IgG (H&L) as the immunogen.

PTCH1 antibody was raised in rabbit using residues 269-279 [KKINYQVDSWE] of the murine PTCH protein as the immunogen.

Rabbit polyclonal GABRA4 antibody

Rabbit polyclonal ZMY11 antibody

Rabbit polyclonal CD19 antibody (Tyr531)

NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV

Semenogelin I antibody was raised using the N terminal of SEMG1 corresponding to a region with amino acids QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL

The IGFBP2 antibody is a cytotoxic monoclonal antibody that is used in various applications in the field of Life Sciences. It is specifically designed to target and neutralize IGFBP2, a protein involved in cellular processes such as cell growth and proliferation. This antibody has been shown to be highly effective in inhibiting the activity of IGFBP2, making it a valuable tool for researchers studying the role of this protein in different biological systems.

GZMM antibody was raised in Rabbit using Human GZMM as the immunogen

Rabbit polyclonal Ovotransferrin antibody (FITC)

Affinity purified Rabbit polyclonal Calsequestrin 2 antibody

The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.

LDB1 antibody was raised in Rabbit using Human LDB1 as the immunogen

NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF

EGFR antibody (AF488) was raised in mouse using human A431 membrane proteins as the immunogen.

PREP antibody was raised using the N terminal of PREP corresponding to a region with amino acids THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF

Affinity purified Rabbit polyclonal Nectin 2 antibody

Mouse monoclonal Granulocytes antibody (FITC)

Rabbit Polyclonal BCL2L12 antibody

The CO1 antibody is a monoclonal antibody that specifically targets and neutralizes the CO1 protein. This protein is involved in various biological processes, including the regulation of brain natriuretic peptide levels and interferon production. The CO1 antibody has been extensively studied in Life Sciences research and has shown promising results as an antiviral agent. It can be used in laboratory experiments to study the function of the CO1 protein or as a potential therapeutic option for certain diseases. The CO1 antibody is formulated with high-quality excipients to ensure stability and efficacy. Additionally, polyclonal antibodies are also available for researchers who require a broader range of target recognition. Trust the CO1 antibody for reliable and accurate results in your scientific endeavors.

The PGD antibody is a powerful tool used in Life Sciences research. It specifically targets 6-phosphogluconate dehydrogenase (PGD), an enzyme involved in the pentose phosphate pathway. This antibody recognizes and binds to PGD, allowing researchers to study its function and regulation.

Rabbit polyclonal WBP11 antibody

MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES