Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
Chicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.
Degré de pureté :Min. 95%L Selectin antibody
The L Selectin antibody is a powerful tool for researchers studying actin filaments and protein kinases. This antibody specifically targets L Selectin, a cell surface glycoprotein involved in leukocyte adhesion and migration. By binding to L Selectin, this antibody can inhibit its function and block the interactions between leukocytes and endothelial cells.
Goat anti Human IgG (H + L)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Degré de pureté :Min. 95%TALDO1 antibody
The TALDO1 antibody is a highly specialized protein that belongs to the group of polyclonal antibodies. It is used in life sciences research to detect and study transaldolase, an important enzyme involved in nucleic acid metabolism. This antibody specifically binds to TALDO1, making it a valuable tool for identifying and quantifying this biomarker in various biological samples. By targeting specific polypeptides, the TALDO1 antibody enables researchers to gain insights into the role of transaldolase in cellular processes and disease development. Its high specificity and sensitivity make it an essential component in many scientific experiments and studies.
BMP2K antibody
BMP2K antibody was raised using the C terminal of BMP2K corresponding to a region with amino acids AQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
Chlorpyrifos antibody
The Chlorpyrifos Antibody is a powerful inhibitory factor that targets antiphospholipid antibodies. This monoclonal antibody has neutralizing properties and is widely used in Life Sciences research. It specifically binds to GM-CSF (granulocyte-macrophage colony-stimulating factor), chemokines, interferons, and E-cadherin. The Chlorpyrifos Antibody can effectively induce lysis of cells expressing these markers and has been extensively tested for its efficacy. It contains excipients to ensure stability and potency. Additionally, this antibody has shown promising results in targeting alpha-fetoprotein, making it a valuable tool in the development of diagnostic and therapeutic applications.
HECTD2 antibody
HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
Factor XI antibody
Factor XI antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is specifically designed to target and bind to Factor XI, a growth factor involved in various physiological processes. This antibody can be used in research settings to study the role of Factor XI in insulin signaling pathways, glycosylation processes, and epidermal growth factor regulation.
CUX2 antibody
CUX2 antibody was raised in rabbit using the N terminal of CUX2 as the immunogen
Degré de pureté :Min. 95%alpha Actinin 1 antibody
alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
Goat anti Mouse IgG + IgM (rhodamine)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Degré de pureté :Min. 95%EPHA2 antibody
The EPHA2 antibody is a highly specialized monoclonal antibody that targets the elastase protein, an enzyme involved in various physiological processes. This antibody has been extensively studied and proven to be effective in inhibiting the activity of elastase. It is widely used in Life Sciences research for its ability to specifically bind to elastase and neutralize its function.
HSV2 gC antibody
HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.
MAGEA3 antibody
MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD
PRKAR1A antibody
PRKAR1A antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets PRKAR1A, a human protein involved in various biochemical processes. This antibody can be used for research purposes, such as studying the role of PRKAR1A in cellular functions and signaling pathways.
PFKP antibody
The PFKP antibody is a highly specialized monoclonal antibody that targets the protein kinase enzyme. It has been extensively studied for its potential therapeutic applications in various fields, including interferon research, non-alcoholic steatohepatitis treatment, and industrial protein kinase inhibitors.
Plakophilin 2 antibody
Plakophilin 2 antibody was raised in mouse using synthetic carboxyterminal peptide (aa 527 - 872) of human plakophilin 2 as the immunogen.
P2X3 antibody
The P2X3 antibody is a monoclonal antibody that has antiestrogen properties. It specifically targets the P2X3 receptor, which is found in adipose tissue and plays a role in various physiological processes. This antibody has been shown to neutralize the activity of the P2X3 receptor, reducing its binding to ligands such as interleukin-6 and natriuretic peptides. By doing so, it can modulate the viscosity of adipose tissue and potentially impact adipocyte function. The P2X3 antibody is also being investigated as a potential therapeutic agent for conditions such as obesity and metabolic disorders. In addition, this antibody can be used in immunoassays for research purposes in the field of life sciences.
PIK3R2 antibody
The PIK3R2 antibody is a highly specialized growth factor antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies, which are known for their high specificity and sensitivity. This antibody specifically targets the PIK3R2 protein, which plays a crucial role in various cellular processes.
IL2 antibody
The IL2 antibody is a monoclonal antibody that specifically targets interleukin-2 (IL-2), a glycoprotein involved in the regulation of immune responses. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and autoimmune disorders.
TLR4 antibody
The TLR4 antibody is a reactive and neutralizing monoclonal antibody that targets Toll-like receptor 4 (TLR4). It is commonly used in research and clinical settings to study the role of TLR4 in various biological processes. This antibody specifically binds to TLR4, preventing its interaction with ligands and downstream signaling molecules. By blocking TLR4 activation, the antibody inhibits the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, it has been shown to inhibit the genotoxic effects of certain substances, making it a valuable tool in genotoxicity studies. The TLR4 antibody is widely used in life sciences research, particularly in the fields of immunology and inflammation. Whether you're studying cholinergic signaling or investigating fatty acid metabolism, this antibody can provide valuable insights into cellular processes regulated by TLR4. Choose our high-quality TLR4 antibody for your
TNF alpha antibody
TNF alpha antibody is a glycoprotein that contains sugar moieties and belongs to the epidermal growth factor (EGF)-like family. It acts as a growth factor and plays a crucial role in various biological processes. This antibody specifically targets TNF-α, a pro-inflammatory cytokine involved in immune responses and inflammatory diseases.
ACADM antibody
ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG
IL4 antibody
The IL4 antibody is a multidrug that targets specific proteins in the body. It has been shown to have a significant impact on human hepatocytes, inhibiting the production of alpha-fetoprotein and anti-glial fibrillary acidic protein. This antibody is part of a class of chimeric proteins known as polyclonal antibodies, which are widely used in Life Sciences research. The IL4 antibody also acts as an inhibitor, blocking the activity of certain enzymes and molecules involved in various biological processes. It is commonly conjugated with biotinylation and can be easily detected using streptavidin-based detection systems. With its high specificity and affinity, the IL4 antibody offers great potential for therapeutic applications and further scientific investigations.
Sheep RBC antibody (Texas Red)
Sheep RBC antibody (Texas Red) was raised in rabbit using sheep erythrocytes as the immunogen.
Rb antibody
The Rb antibody is a highly specialized monoclonal antibody that targets mesenchymal stem cells. It acts as an anti-connexin agent, inhibiting the function of connexin proteins involved in cell communication. Additionally, this antibody has a high affinity for collagen and metal-binding proteins, making it an ideal tool for studying extracellular matrix interactions. The Rb antibody has also been used in research related to thrombotic thrombocytopenic purpura (TTP), a blood disorder characterized by clot formation in small blood vessels. Furthermore, polyclonal antibodies derived from this monoclonal antibody have been developed, allowing for broader applications in the life sciences field. It is important to note that proper handling and storage of this antibody are crucial to avoid contaminants and maintain its efficacy.
alpha Tubulin antibody
The alpha Tubulin antibody is a monoclonal antibody that specifically targets and neutralizes alpha-tubulin, a protein involved in the formation of actin filaments. This antibody has been shown to have high affinity for alpha-tubulin and can effectively inhibit its activity. It has also been demonstrated to bind to other proteins such as alpha-fetoprotein and receptors, further highlighting its versatility.SERPINE1 antibody
SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMDegré de pureté :Min. 95%Annexin A2 antibody
The Annexin A2 antibody is a highly specific monoclonal antibody that targets the Annexin A2 protein. This antibody is commonly used in Life Sciences research and diagnostics. Annexin A2 is an acidic protein that plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. It has been shown to interact with epidermal growth factor (EGF) and act as a co-receptor for EGF receptor signaling.
STAT6 antibody
The STAT6 antibody is a protein-based antibody that specifically targets and binds to the STAT6 protein. This protein plays a crucial role in cellular signaling pathways and is involved in various biological processes such as immune response, cell growth, and differentiation. The STAT6 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and immunofluorescence.
IL6 antibody
IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a multifunctional cytokine involved in various biological processes. IL-6 acts as both a pro-inflammatory and anti-inflammatory mediator, playing a crucial role in immune response regulation. The IL6 antibody binds to IL-6 and neutralizes its activity, preventing it from binding to its receptors and initiating downstream signaling pathways.
SAMHD1 antibody
The SAMHD1 antibody is a highly specialized tool used in various assays and research applications. It specifically targets SAMHD1, an EGF-like glycoprotein involved in cellular processes. This antibody is designed to inhibit the activity of SAMHD1 and can be used as a valuable tool for studying its function.
NAT9 antibody
NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ
RAB5A antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
TFEB antibody
The TFEB antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the transcription factor EB (TFEB), a protein involved in the regulation of various cellular processes. This antibody has been shown to be effective in detecting TFEB in different tissues and cell types, including adipose tissue. By binding to TFEB, this antibody can help researchers study its role in cellular processes such as autophagy, lysosomal biogenesis, and lipid metabolism.
PSA antibody
The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.
STT3B antibody
The STT3B antibody is a powerful tool in the field of Life Sciences. It is widely used in research and diagnostic applications due to its high specificity and sensitivity. This antibody has been extensively tested and proven to be effective in various experiments.
Anti-HIV P24 monoclonal antibody
Please enquire for more information about Anti-HIV P24 monoclonal antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
EGFR antibody
The EGFR antibody is a highly specialized monoclonal antibody that targets the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in cell growth and division, making it an important target for cancer treatment. The EGFR antibody works by binding to the EGFR on the surface of cancer cells, blocking its activation and preventing further cell proliferation.
ZFP36 antibody
The ZFP36 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to the protein known as ZFP36. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and mRNA stability.IL4 antibody
The IL4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes interleukin-4 (IL-4), a glycan involved in various biological processes. This antibody has been extensively studied for its potential therapeutic applications.
S6K1 antibody
The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this
Degré de pureté :Min. 95%NODAL antibody
NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ
SLCO1B1 antibody
SLCO1B1 antibody was raised in rabbit using the middle region of SLCO1B1 as the immunogenDegré de pureté :Min. 95%IFN gamma antibody
IFN gamma antibody was raised in mouse using highly pure recombinant human IFN-gamma as the immunogen.IL8 antibody
The IL8 antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and bind to interleukin-8 (IL-8), a chemokine involved in inflammation and immune response. This antibody has shown great potential in various research applications, including immunohistochemistry, where it can be used to detect IL-8 expression in tissue samples.
