Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
SOCS3 antibody
The SOCS3 antibody is a highly effective histone deacetylase inhibitor that has shown promising results in various medical applications. This monoclonal antibody acts by targeting and neutralizing the activity of p38 MAPK, a protein involved in the regulation of immune responses. By inhibiting p38 MAPK, the SOCS3 antibody helps to modulate inflammatory processes and reduce tissue damage.Fibrinopeptide A antibody (HRP)
Fibrinopeptide A antibody (HRP) was raised in sheep using Synthetic Fibrinopeptide A 1-16 conjugated to carrier as the immunogen.
Carbonic anhydrase IX antibody
The Carbonic anhydrase IX antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences. This antibody is specifically designed to target and neutralize the activated form of carbonic anhydrase IX, which is found in human serum and plays a crucial role in various physiological processes.
RTN2 antibody
RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE
Glutathione Peroxidase 2 antibody
Affinity purified Rabbit polyclonal Glutathione Peroxidase 2 antibody
CHKA antibody
CHKA antibody was raised using the middle region of CHKA corresponding to a region with amino acids LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI
MMP10 antibody
The MMP10 antibody is a polyclonal antibody that is used in immunohistochemical studies to detect the presence of matrix metalloproteinase 10 (MMP10) protein. This antibody is widely used in life sciences research to study various cellular processes, including pluripotent stem cell differentiation and hematopoietic development. The MMP10 antibody can be used as a valuable tool for researchers to investigate the expression and localization of MMP10 in different tissues and cell types. It can also be used to inhibit the activity of MMP10 or as a therapeutic reagent in the development of new cytokine inhibitors. With its high specificity and sensitivity, the MMP10 antibody is an essential component for any researcher working in the field of molecular biology and immunology.
DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
PPP1R3B antibody
PPP1R3B antibody was raised in rabbit using the N terminal of PPP1R3B as the immunogen
CTBP1 antibody
The CTBP1 antibody is a polyclonal antibody that is used in Life Sciences research. It has a high affinity for the low-density lipoprotein receptor-related protein 1 (LRP1) and can be used to study its role in various cellular processes. The CTBP1 antibody has been shown to inhibit the binding of epidermal growth factor (EGF) to LRP1, suggesting that it may play a role in EGF signaling pathways. Additionally, this antibody has been used to detect autoantibodies against CTBP1 in patients with certain autoimmune diseases. The CTBP1 antibody can be used in various techniques such as immunohistochemistry, western blotting, and ELISA to detect and quantify CTBP1 expression levels. Its specificity and sensitivity make it an ideal tool for researchers studying the function of CTBP1 and its potential as a therapeutic target.
POU2F1 antibody
The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.
Desmoglein 3 antibody
Desmoglein 3 antibody was raised in mouse using recombinant human polypeptide Desmoglein 3 as the immunogen.
BTN3A2 antibody
The BTN3A2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the BTN3A2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting the presence of BTN3A2.
BRAF antibody
The BRAF antibody is a powerful tool in the field of Life Sciences. It is an inhibitor that specifically targets BRAF, a protein involved in cell growth and division. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer.
AC antibody
AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
BHMT antibody
The BHMT antibody is a monoclonal antibody that specifically targets the ubiquitin protein. It has been extensively studied for its role in various biological processes, including the regulation of protein kinase activity and endothelial growth. This antibody is widely used in research assays and has proven to be a valuable tool in the field of Life Sciences.
Human Growth Hormone antibody (HRP)
Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.
EWSR1 antibody
EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
Pirimiphos antibody
Pirimiphos antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the category of polyclonal antibodies and is commonly used for research purposes. This antibody specifically targets insulin, a hormone that plays a crucial role in regulating blood sugar levels. By binding to insulin, Pirimiphos antibody can be used to study insulin signaling pathways and its involvement in various physiological processes.
CLDN4 antibody
The CLDN4 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of CLDN4, a protein that is activated in certain diseases. This antibody has shown promising results in inhibiting the growth of tumors expressing high levels of alpha-fetoprotein, a known marker for liver cancer. Additionally, the CLDN4 antibody has been found to block the chemokine signaling pathway, which plays a crucial role in cell migration and inflammation. It also acts as a serine protease inhibitor, preventing the activation of enzymes involved in tumor progression. With its high specificity and efficacy, this antibody holds great potential for therapeutic applications in the field of Life Sciences.
DDX39 antibody
DDX39 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 39 (Ddx39)KLRC1 antibody
The KLRC1 antibody is a polyclonal antibody that specifically targets the chemokine-activated receptor KLRC1. This antibody is commonly used in life sciences research and has been shown to have high affinity and specificity for KLRC1. It can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA. The KLRC1 antibody has been proven effective in detecting KLRC1 expression in human serum samples and has been used to study its role in various biological processes. This antibody has also been utilized in the development of therapeutic inhibitors targeting KLRC1 signaling pathways. With its reliable performance and versatility, the KLRC1 antibody is an essential tool for researchers studying protein kinases and their associated pathways.
Neuropsin antibody
The Neuropsin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activated form of Neuropsin, an enzyme involved in various physiological processes. This antibody has been shown to inhibit the activity of Neuropsin, which plays a crucial role in fatty acid metabolism and the regulation of inflammatory responses.
Calcitonin antibody
Calcitonin antibody is a powerful tool used in life sciences research and diagnostics. It is a type of polyclonal antibody that specifically targets the growth hormone receptor. This antibody recognizes and binds to the receptor, blocking its activity and preventing the binding of growth hormone.
HIV1 gp41 antibody (HRP)
HIV1 gp41 antibody (HRP) was raised in goat using recombinant ectodomain of gp41 as the immunogen.RALA antibody
The RALA antibody is a glycopeptide that acts as an anticoagulant by neutralizing the viscosity of fibrinogen. It belongs to the class of peptide agents known as antibodies, which are widely used in Life Sciences research. This antibody specifically binds to glycan-binding proteins and has been shown to have toxic effects on various cell types. Additionally, it has been found to inhibit the activity of colony-stimulating factors such as interleukin-6, making it a valuable tool for studying immune responses and cell signaling pathways. The RALA antibody is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein, increasing its versatility in experimental applications.
PKC alpha antibody
The PKC alpha antibody is a highly specialized antibody that targets the protein kinase C alpha (PKCα) enzyme. It is commonly used in life sciences research to study various cellular processes and signaling pathways. This monoclonal antibody specifically binds to the activated form of PKCα, allowing researchers to detect and analyze its activity in different cell types.
FBXL5 antibody
FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids VHWARGDWYSGPATELDTEPDDEWVKNRKDESRAFHEWDEDADIDESEES
Factor V antibody
Factor V antibody was raised in sheep using human factor V purified from plasma as the immunogen.
KSHV K8 alpha antibody
KSHV K8 alpha antibody was raised in Mouse using a purified recombinant fragment of KSHV K8alpha expressed in E. coli as the immunogen.KYNU antibody
KYNU antibody is a polyclonal antibody that specifically targets kynureninase (KYNU), an enzyme involved in the metabolism of tryptophan. KYNU plays a crucial role in the production of kynurenic acid, which has been implicated in various neurological and psychiatric disorders. This antibody can be used in research assays to detect and quantify KYNU levels in biological samples, allowing for a better understanding of its function and potential therapeutic applications. With its high specificity and sensitivity, the KYNU antibody is a valuable tool for scientists and researchers working in the field of life sciences. Whether studying autoimmune diseases, developing new medicines, or exploring the role of kynurenine pathway intermediates, this antibody provides reliable results and contributes to advancements in biomedical research.
Bax antibody
The Bax antibody is a monoclonal antibody that specifically targets the protein Bax. Bax plays a crucial role in regulating cell death and apoptosis. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
GFAP antibody
The GFAP antibody is a highly specialized antibody that targets glial fibrillary acidic protein (GFAP). This protein is primarily expressed in astrocytes, a type of glial cell in the central nervous system. The GFAP antibody has been extensively used in various research fields, including Life Sciences and Neuroscience.
PTS antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
GAP43 antibody
The GAP43 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used to study the role of interferon in cellular processes. The antibody is produced by immunizing animals with GAP43, a protein found in the nervous system. It has high specificity and affinity for its target, making it an ideal tool for detecting and quantifying GAP43 levels in various biological samples.
PLEKHF1 antibody
The PLEKHF1 antibody is a highly specialized monoclonal antibody that serves as a serum marker for various medical conditions. This antibody specifically targets and binds to the PLEKHF1 antigen, which plays a crucial role in the regulation of interleukin production and immune response. By inhibiting the activity of PLEKHF1, this antibody can be used as a potential medicament in the treatment of autoimmune diseases, inflammatory disorders, and certain types of cancers.
HPRT antibody
The HPRT antibody is a highly specialized monoclonal antibody that is used in various assays and experiments in the field of Life Sciences. It specifically targets the hypoxanthine-guanine phosphoribosyltransferase (HPRT) enzyme, which plays a crucial role in the metabolism of purine nucleotides.
GEM antibody
GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
NSE antibody
The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.
