Anticorps primaires

GPR161 antibody was raised in Rabbit using Human GPR161 as the immunogen

Rabbit polyclonal TRMT5 antibody

Rabbit polyclonal KITH antibody

HDAC3 antibody was raised in Rabbit using Human HDAC3 as the immunogen

Mouse monoclonal C1orf50 antibody

Rabbit polyclonal HTR7 antibody

Mouse thrombocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymocytes as the immunogen.

GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT

A2M antibody was raised in Rabbit using Human A2M as the immunogen

DGUOK antibody was raised in Rabbit using Human DGUOK as the immunogen

Mouse monoclonal TUBA8 antibody

Rabbit polyclonal FGF2 antibody (FITC)

CADPS antibody was raised in Rabbit using Human CADPS as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth.

MCP4 antibody was raised in mouse using highly pure recombinant human MCP-4 as the immunogen.

CD11c antibody (biotin) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.

IFT52 antibody was raised in Rabbit using Human IFT52 as the immunogen

CBR3 antibody was raised in Rabbit using Human CBR3 as the immunogen

Rabbit polyclonal GABRA6 antibody

Sheep polyclonal Norfluoxetine antibody

The DCTN1 antibody is a highly specialized monoclonal antibody that targets the DCTN1 protein. This protein plays a crucial role in various cellular processes, including intracellular transport and organization of microtubules. By specifically binding to the DCTN1 protein, this antibody can modulate its function and activity.

Mouse monoclonal CD25 antibody (biotin)

Affinity purified Rabbit polyclonal ASNA1 antibody

Donkey anti-guinea pig IgG (H + L) (HRP) was raised in donkey using guinea pig IgG (H & L) as the immunogen.

Rabbit polyclonal CPLA2 antibody (Ser505)

LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL

Rabbit polyclonal CDK11A antibody

FITC antibody (biotin) was raised in goat using fluorescein conjugated to goat IgG as the immunogen.

DISP1 antibody was raised in Rabbit using Human DISP1 as the immunogen

NFKBIA antibody was raised in rabbit using the N terminal of NFKBIA as the immunogen

CTSF antibody was raised in Rabbit using Human CTSF as the immunogen

TIPIN antibody was raised in rabbit using the N terminal of TIPIN as the immunogen

Affinity purified Rabbit polyclonal EIF5A2 antibody

The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.

FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE

Rabbit polyclonal TPH1 antibody (Ser260)

Rabbit polyclonal SERPINB5 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal PFN4 antibody

Rabbit polyclonal PTDSS1 antibody (HRP)

Granzyme A antibody is a monoclonal antibody that specifically targets and binds to granzyme A, a serine protease enzyme involved in immune response and cell death. This antibody can be used for various applications in the field of Life Sciences, including research on immune system function, cancer therapy, and autoimmune diseases. It has been shown to inhibit the activity of granzyme A by blocking its binding to target cells. Additionally, this antibody has been used in experiments to study the effects of granzyme A on dopamine release, hormone peptide processing, and liver microsome metabolism. With its high specificity and affinity for granzyme A, this monoclonal antibody is a valuable tool for researchers studying immune regulation and cell signaling pathways.

Rabbit polyclonal 14-3-3 alpha/beta antibody (FITC)

Affinity purified Rabbit polyclonal MORG1 antibody

Mouse monoclonal PDE1B antibody

Rabbit polyclonal USP49 antibody

HMG20B antibody was raised in Rabbit using Human HMG20B as the immunogen

CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL

CD11a antibody (Azide Free) was raised in rat using murine CD11a (LFA-1a) as the immunogen.

CD8a antibody (Spectral Red) was raised in rat using murine thymus or spleen as the immunogen.

CCL28 antibody was raised in Rabbit using Human CCL28 as the immunogen

The IL8 antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and bind to interleukin-8 (IL-8), a chemokine involved in inflammation and immune response. This antibody has shown great potential in various research applications, including immunohistochemistry, where it can be used to detect IL-8 expression in tissue samples.

FZR1 antibody was raised in Rabbit using Human FZR1 as the immunogen

GZMM antibody was raised in Rabbit using Human GZMM as the immunogen

The p70 antibody is a highly specialized product in the field of Life Sciences. It is commonly used in chromatographic techniques to detect and analyze the presence of activated proteins, such as β-catenin and cox-2 inhibitor. This antibody is also widely used in bioassays and immunoassays to study the expression and localization of specific proteins, including collagen and ginsenoside.

The KLK5 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as an inhibitor of endothelial growth factor, acidic neurotrophic factor, and colloidal antibodies. Additionally, it has neutralizing properties against glucagon and tyrosine growth factor.

The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.

Affinity purified Rabbit polyclonal MIP1 beta antibody

TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI

The IL3 antibody is a receptor molecule that has neutralizing properties. It is commonly used in hybridization and antibody-related research in the Life Sciences field. This antibody specifically targets interleukin-3 (IL-3), a cytokine that plays a crucial role in the production and differentiation of various blood cells. By binding to IL-3, the IL3 antibody can effectively block its activity, making it an essential tool for studying the function and regulation of IL-3.

NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF

The Histamine H3 Receptor antibody is a high-quality monoclonal antibody that specifically targets the histamine H3 receptor. This antibody is widely used in life sciences research, including studies on human histamine receptors, egf-like growth factors, and cytotoxic assays. It has been proven to be highly effective in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.

FXN antibody was raised in Rabbit using Human FXN as the immunogen

The NFIB antibody is a polyclonal antibody that is used in various immunoassays and life sciences research. It specifically targets the nuclear factor I/B (NFIB) protein, which plays a crucial role in regulating gene expression and cellular processes. This antibody is highly specific and has been validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence.

The BMP6 antibody is a highly specialized collagen-based polyclonal antibody that targets the tyrosine residues in BMP6. This antibody is widely used in life sciences research to study the role of BMP6 in various biological processes. It has been shown to interact with multiple proteins, including plasminogen activator receptor, urokinase plasminogen activator, and alpha-fetoprotein. The BMP6 antibody is available as both a monoclonal and polyclonal antibody, offering researchers flexibility in their experimental design. This antibody has potential therapeutic applications, particularly in the treatment of thrombocytopenia and as a growth factor for tissue repair. Additionally, it has been found to have interactions with hyaluronic acid, further expanding its potential applications in regenerative medicine.

G3BP antibody was raised using the N terminal Of G3Bp corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE

FAM98A antibody was raised using the middle region of FAM98A corresponding to a region with amino acids QKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGRGGRGGYDHGGRG

This product is a protein A purified mouse monoclonal antibody with clones of the immunoglobulin subclasses: IgG1 and IgG2a available. These clones recognise human D-Dimer and high molecular weight fibrin degradation products and no cross-reactions is observed with fibrinogen and D-monomer. A potential application of this product is for coating to latex particles for latex enhanced immunoturbidimetric applications. It can further be used in ELISA and immunofluorescent assays.
Human D-dimer, a soluble fibrin degradation product recognised by this antibody product, can be used as a marker for clinical conditions where the process of coagulation and fibrinolysis have been activated. For example it can be used in the diagnosis of venous thromboembolism and intravascular coagulation. The formation of human D-dimer occurs when fibrinogen is converted to fibrin monomers when the enzyme thrombin cleaves fibrinopeptides at the N-terminal domain of fibrinogen. These monomers aggregate when interacting with another enzyme: activated factor XIII (factor XIIIa) forming a cross-linked fibrin polymer, also known as a fibrin clot. A final enzyme, plasmin, degrades this fibrin clot, resulting in D-dimer. It is important to note that when applying this product clinically, levels of D-dimer can be influenced by human factors such as age, pregnancy and cancer.

Rabbit Polyclonal Kir6.2 antibody (Thr224)

CD4 antibody was raised in Rabbit using Human CD4 as the immunogen

SLC22A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD

DNAL4 antibody was raised in Rabbit using Human DNAL4 as the immunogen

A Mouse Monoclonal Antibody complementary to recombinant Chikungunya envelope 1 (E1) and 2 (E2) proteins, which is available as the immunoglobulin subclass IgG1. The product has been purified by ion exchange chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.
Transmitted by mosquito vectors, Chikungunya is a positive-stranded RNA, alpha virus infecting human musculoskeletal tissues. The two glycoproteins E1 and E2 of the Chikungunya virus, to which this Mab is complementary, are responsible for viral entry into host cells and both contain a transmembrane domain. Furthermore E2 has the three globular domains A, B and C which are linked by a β-ribbon connector region. While E2 is essential for mediating viral attachment, E1’s β-sheet structure and class II viral glycoproteins: DI, DII and DIII domains enable the virus to fuse with the host’s membrane. This primarily occurs through the insertion of the DII domain’s fusion loop into the host’s cell membrane.
Together E1 and E2 form a viral spike protein which when binding with high affinity to host alphavirus receptors such as Mxra8, allow this receptor to be inserted into E1 and E2. This results in Mxra8 contact between E2’s A and B domains and E1’s fusion loop. Neutralising antibodies can target these domains, in particular A and B domains within E2, hence preventing viral attachment to host cells. Consequently this antibody could be used to investigate possible treatments to combat Chikungunya virus. Another potential application of this product could be used in antibody and antigen interaction dependent assays to detect the presence of the Chikungunya virus.

CD105 antibody was raised in rabbit using recombinant human soluble CD105/Endoglin as the immunogen.

JAKMIP2 antibody was raised in Rabbit using Human JAKMIP2 as the immunogen

Affinity purified Rabbit polyclonal TBCK antibody

The MTAP antibody is a highly specialized product in the field of Life Sciences. It is a nuclear monoclonal antibody that has been developed for various applications, including antinociceptive research. This antibody specifically targets the retinoid-binding protein MTAP, which is found in high levels in certain tissues and cells.

The Myc antibody is a monoclonal antibody that specifically targets the protein Myc. It belongs to the family of kinase inhibitors and is widely used in Life Sciences research. This antibody has shown high affinity for Myc, making it a valuable tool for studying the functions and interactions of this protein.

Rabbit polyclonal RPL30 antibody

Mouse monoclonal EXOSC7 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and contains active compounds that effectively inhibit bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

Rat monoclonal CD9 antibody (FITC)

Affinity purified Rabbit polyclonal Histone H3.3B antibody

Affinity purified Rabbit polyclonal FLRT1 antibody

CYP3A4 antibody was raised in Rabbit using Human CYP3A4 as the immunogen

The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.

The Fascin 1 antibody is a highly specialized monoclonal antibody that targets and binds to the protein Fascin 1. Fascin 1 is involved in various cellular processes, including cell adhesion, migration, and cytoskeletal organization. This antibody has been extensively studied in Life Sciences research and has shown inhibitory properties against Fascin 1 activity.

Rabbit anti-sheep IgG (Rhodamine) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.

The ADAM10 antibody is a highly specialized cytotoxic antibody that targets the tyrosine protease ADAM10. It is widely used in Life Sciences research, particularly in immunohistochemistry studies. This polyclonal antibody has been shown to inhibit the activity of ADAM10, which plays a crucial role in various cellular processes such as interleukin-6 and insulin signaling. The ADAM10 antibody is commonly used as a tool to study the function of this protein and its involvement in disease pathways. Researchers also use monoclonal antibodies against ADAM10 for specific applications, such as insulin or interleukin detection. Additionally, this antibody has potential therapeutic applications due to its ability to modulate ADAM10 activity and downstream effects on cellular processes. Its specificity and high affinity make it an essential tool for studying the biology of ADAM10 and its associated pathways.