Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
Influenza A antibody
Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.
LXN antibody
The LXN antibody is a monoclonal antibody that is used to detect and study angiogenic factors. It can be used in various research applications, including immunohistochemistry and Western blotting. The LXN antibody specifically recognizes and binds to a target protein, allowing for the detection and analysis of its expression levels. This antibody has been shown to inhibit syncytia formation and block the activity of certain growth factors. Additionally, it has been found to have cholinergic activity and can modulate the function of nucleotide molecules. The LXN antibody is available as a ready-to-use solution and can be easily incorporated into experimental protocols.
NR1H3 antibody
The NR1H3 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor NR1H3. This receptor plays a crucial role in the immune response to viral infections by regulating the activity of serine proteases and other key molecules involved in antiviral defense. The NR1H3 antibody has been extensively studied and proven to be effective in neutralizing the activity of NR1H3, thereby inhibiting viral replication and spread.
SERP1 antibody
The SERP1 antibody is a polyclonal antibody that targets nuclear and adipose tissues. It is widely used in life sciences research for its neutralizing properties against glycoproteins. This antibody has been shown to be effective in inhibiting connexin agents and promoting endothelial growth. It can also be used as a diagnostic tool for detecting alpha-fetoprotein levels in human serum. The SERP1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody is an essential tool for studying various biological processes and diseases.
NPDC1 antibody
NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL
QTRT1 antibody
QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
CD8a antibody
CD8a antibody was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.
Lactoferrin antibody
Lactoferrin antibody was raised in Mouse using Human lactoferrin as the immunogen.PRKAR2A antibody
PRKAR2A antibody was raised in rabbit using the middle region of PRKAR2A as the immunogen
GSTP1 antibody
The GSTP1 antibody is a polyclonal antibody that specifically targets the glutathione S-transferase pi 1 (GSTP1) protein. This protein is an important member of the GST family, which plays a crucial role in detoxification processes within cells. The GSTP1 antibody is designed to recognize and bind to the GSTP1 protein, allowing for its detection and analysis in various biological samples.
GAPDH antibody
The GAPDH antibody is a highly specific monoclonal antibody that is used for various applications in the field of Life Sciences. This antibody has been extensively tested and validated using human serum samples, making it a reliable tool for research. It binds specifically to glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a key enzyme involved in glycolysis and other cellular processes.
PSMB4 antibody
PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV
FLT1 antibody
The FLT1 antibody is a protein that plays a crucial role in Life Sciences. It is composed of acid residues and has been extensively studied for its various functions. This antibody specifically targets the FLT1 receptor, which is involved in regulating processes such as dopamine signaling, nuclear transport, and growth factor signaling. Additionally, it has been found to bind to antigens such as the circumsporozoite protein and ubiquitin. The FLT1 antibody has also shown potential in promoting fas-mediated apoptosis and inhibiting endothelial growth. With its versatility and wide range of applications, this antibody is an essential tool for researchers in the field of Life Sciences.
GALNS antibody
The GALNS antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. This antibody specifically targets and binds to a specific antigen, allowing for precise detection and analysis of various biological processes. In addition to its use as a diagnostic tool, the GALNS antibody has also been found to have therapeutic potential.
Mycoplasma pneumoniae antibody
Mycoplasma pneumoniae antibody is a specialized protein that targets the circumsporozoite protein of the bacteria. This antibody has been shown to have anti-glial fibrillary acidic properties, acting as a growth factor and neurotrophic agent. It is a monoclonal antibody that specifically neutralizes Mycoplasma pneumoniae and has been extensively studied in the field of Life Sciences. The antibody has also been found to exhibit tyrosine phosphatase activity and has potential neuroprotective effects. With its unique properties, this Mycoplasma pneumoniae antibody offers promising applications in various research areas and can be a valuable tool for scientists studying antibodies and their functions.
BP1 antibody
The BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to BP1, a protein that is found in human serum. The binding of the BP1 antibody to its target protein can be used for various applications, including research and diagnostic purposes.
Monkey RBC antibody (Texas Red)
Monkey RBC antibody (Texas Red) was raised in rabbit using monkey erythrocytes as the immunogen.
MUC2 antibody
The MUC2 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It targets the MUC2 protein, which plays a crucial role in maintaining the integrity of the mucosal barrier in various tissues. This antibody can be used for research purposes to study the function and regulation of MUC2 in different biological processes.
MAD2 antibody
The MAD2 antibody is a highly effective active agent that plays a crucial role in regulating cell division. It specifically targets messenger RNA (mRNA) and cell antigens, making it an essential tool in the field of Life Sciences. The MAD2 antibody is available in both polyclonal and monoclonal forms, providing researchers with versatile options for their experiments.
Caspase 8 antibody
Caspase 8 antibody is a highly specific monoclonal antibody that targets caspase 8, an enzyme involved in programmed cell death. This antibody has been extensively tested and validated for its ability to detect and inhibit caspase 8 activity. It can be used in various life science research applications including immunohistochemistry, western blotting, and flow cytometry. The Caspase 8 antibody has been shown to effectively block the activity of caspase 8, making it a valuable tool for studying apoptosis and cell death pathways. Its high specificity ensures accurate and reliable results, making it an essential component in many research projects.
SIX1 antibody
The SIX1 antibody is a polyclonal antibody that specifically targets the SIX1 protein. This antibody is commonly used in research and diagnostic applications to detect the presence of SIX1 in various samples. It can be used in techniques such as immunohistochemistry, Western blotting, and ELISA.
NPM antibody
Nucleolar Protein NO38 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.GPR132 antibody
The GPR132 antibody is a specific antibody used in Life Sciences research. It is commonly used for the detection and analysis of GPR132 protein expression. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and flow cytometry. GPR132 is involved in several biological processes including the regulation of TGF-beta signaling, interferon production, and alpha-fetoprotein expression. The GPR132 antibody has also been used in studies investigating the therapeutic effects of antibodies such as adalimumab and growth factor inhibitors. Additionally, it has been employed to detect autoantibodies and evaluate their role in diseases associated with TNF-alpha and erythropoietin signaling pathways. With its high specificity and reliability, the GPR132 antibody is an essential tool for researchers exploring various aspects of cellular function and disease mechanisms.
MBP antibody
The MBP antibody is a highly specialized antibody that targets and neutralizes myelin basic protein (MBP). MBP is a key component of the myelin sheath, which surrounds and protects nerve fibers in the central nervous system. By targeting MBP, this antibody can disrupt the normal functioning of myelin and has potential applications in autoimmune disorders such as multiple sclerosis.
SH2 antibody
The SH2 antibody is a monoclonal antibody that specifically targets and neutralizes the activity of growth factors in the body. It is designed to bind to specific acid residues on these growth factors, preventing them from interacting with their receptors and initiating cellular responses. This antibody has been extensively studied in Life Sciences research and has shown promising results in inhibiting the activity of various growth factors, including TGF-beta, epidermal growth factor (EGF), and transferrin.
POSTN antibody
The POSTN antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize the activity of periostin (POSTN), a growth factor protein involved in various cellular processes. This antibody has been extensively tested and proven to effectively bind to POSTN, inhibiting its function.
Myoglobin antibody
Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
PSMD4 antibody
The PSMD4 antibody is a neutralizing monoclonal antibody that targets antiphospholipid antibodies. It is used as a test substance in various research applications, including in vitro and in vivo studies. This antibody specifically binds to the PSMD4 protein, which is an essential component of the 26S proteasome. The PSMD4 antibody has been shown to effectively neutralize the activity of autoantibodies, preventing their harmful effects on cells and tissues. It can be used in immunoassays to detect the presence of PSMD4 or as a tool for studying its function and interactions with other molecules. With its high specificity and affinity for PSMD4, this monoclonal antibody is a valuable resource for researchers in the field of Life Sciences.
PD1 antibody
PD1 antibody is a protein that belongs to the family of antibodies. It plays a crucial role in regulating the immune response and preventing autoimmune diseases. PD1 antibody binds to the programmed cell death protein 1 (PD-1), which is expressed on the surface of T cells, B cells, and other immune cells. By binding to PD-1, this antibody blocks its interaction with programmed death-ligand 1 (PD-L1) and programmed death-ligand 2 (PD-L2), inhibiting the inhibitory signals that suppress T cell activation.
Adiponectin antibody
The Adiponectin antibody is a monoclonal antibody that specifically targets and inhibits the formation of adiponectin, a protein found in human serum. Adiponectin plays a crucial role in regulating insulin sensitivity and lipid metabolism, making it an important target for research in the field of Life Sciences. This antibody effectively blocks the interaction between adiponectin and its receptors, preventing downstream signaling pathways involved in hepatic steatosis and interferon production. By inhibiting the formation of TGF-β1, the Adiponectin antibody also has potential therapeutic applications in conditions such as ischemia-reperfusion injury. The high specificity and affinity of this monoclonal antibody ensure reliable results in antigen-antibody reactions. It can be used in various techniques, including particle reactions and cellulose-based assays. Researchers can rely on its performance to accurately detect and quantify adiponectin levels in different biological samples. Overall, the Adiponectin antibody
Rabbit anti Mouse IgG2b (HRP)
Rabbit anti-mouse IgG2b (HRP) was raised in rabbit using murine IgG2b heavy chain as the immunogen.
Clostridium difficile toxin A antibody
Clostridium difficile toxin A antibody is a highly specialized antibody that specifically targets the cytotoxic molecule produced by Clostridium difficile bacteria. This antibody, available in both polyclonal and monoclonal forms, is used to neutralize the toxin and prevent its harmful effects on cells. By binding to the toxin, the antibody inhibits its ability to cause cell cytotoxicity.
NSUN4 antibody
NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP
PRMT2 antibody
PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
TSTA3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth.
NAB1 antibody
NAB1 antibody was raised in mouse using recombinant Human Ngfi-A Binding Protein 1 (Egr1 Binding Protein 1)
CKMM antibody
CKMM antibody was raised in mouse using CKMM purified from human smooth muscle as the immunogen.EphA3 antibody
EphA3 antibody was raised in Mouse using a purified recombinant fragment of EphA3(aa751-983) expressed in E. coli as the immunogen.
DAPK3 antibody
The DAPK3 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of DAPK3, a chemokine-activated serine/threonine kinase. This antibody has been extensively tested and proven to effectively inhibit the function of DAPK3 in various experimental settings.
DSG3 antibody
DSG3 antibody is a monoclonal antibody used in the field of Life Sciences as an important tool for research and development. It specifically targets the desmoglein 3 protein, which is involved in cell adhesion and plays a crucial role in various physiological processes. The DSG3 antibody can be used to study the function of this protein, investigate its interactions with other molecules such as growth factors or oncolytic adenoviruses, and explore its potential as a therapeutic target.
CIITA antibody
The CIITA antibody is a powerful tool in the field of immunology. This antibody specifically targets and binds to the CIITA antigen, which plays a crucial role in immune system regulation. By binding to CIITA, this antibody can modulate immune responses and has potential applications in various areas of research and medicine.
CDC42 antibody
The CDC42 antibody is a highly specific and potent polyclonal antibody that targets the protein CDC42. It can also be used as a monoclonal antibody. CDC42 is a small GTPase protein that plays a crucial role in various cellular processes, including cell growth, migration, and differentiation. This antibody has been extensively tested and validated for its ability to neutralize the activity of CDC42, making it an invaluable tool for researchers in the field of life sciences.
Peripherin antibody
Peripherin antibody is a polyclonal antibody that specifically targets and neutralizes interleukin, a key player in various immune responses. This antibody is highly effective in blocking the activity of interleukin and can be used in research and diagnostic applications. The colloidal nature of this antibody allows for easy and efficient binding to target molecules, ensuring accurate and reliable results. In addition to its neutralizing properties, peripherin antibody has been shown to inhibit the signaling pathway involving β-catenin, a protein involved in cell adhesion and growth regulation. This makes it a valuable tool for studying the role of β-catenin in various biological processes. Furthermore, this antibody has been successfully used in studies involving helicobacter growth factor and epidermal growth factor, further highlighting its versatility in different research areas. With its high specificity and affinity, peripherin antibody is an essential component for any life sciences laboratory or research facility.
FAM135B antibody
FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
SUV39H1 antibody
The SUV39H1 antibody is a high-quality polyclonal antibody that specifically targets the SUV39H1 protein. This protein is a histone methyltransferase that plays a crucial role in gene regulation and chromatin organization. The SUV39H1 antibody is designed to detect and bind to the activated form of SUV39H1, making it an essential tool for researchers studying epigenetics and gene expression.
