Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
Goat anti Human IgM (mu chain)
This antibody reacts with heavy chains on human IgM (mu chain).Degré de pureté :Min. 95%p53 antibody
The p53 antibody is a highly specialized cytotoxic antibody that plays a crucial role in regulating cell growth and preventing tumor formation. It is known for its ability to target and neutralize antiphospholipid antibodies, which can lead to autoimmune disorders. Additionally, the p53 antibody has been shown to inhibit the activity of tyrosinase, an enzyme involved in melanin production, making it a potential treatment option for hyperpigmentation disorders.
Degré de pureté :Min. 95%Goat anti Mouse IgG + IgM (H + L) (HRP)
Goat anti-mouse IgG/IgM (H+L) (HRP) was raised in goat using murine IgG and IgM whole molecules as the immunogen.Degré de pureté :Min. 95%CYP2J2 antibody
The CYP2J2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect the CYP2J2 enzyme, which plays a crucial role in the metabolism of drugs and other foreign substances in the body. This antibody is commonly used in studies involving mesenchymal stem cells, reactive oxygen species, and electrode-based assays.
Listeria antibody
The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.
Hepatitis C Virus antibody
HCV antibody was raised in rabbit using residues 33-43 [CGVYLLPRRGPR] of HCV core, env, and part of E2/NS1 of HCV as the immunogen.Degré de pureté :Min. 95%Rat anti Human IgG1
Rat anti Human IgG1 antibody was raised in Rat using A fusion protein containing human IgG1 Fc as the immunogen.Degré de pureté :Min. 95%MFAP3L antibody
MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
AVEN antibody
The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.
TM9SF1 antibody
TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG
PF4 antibody
PF4 antibody was raised in sheep using Platelet Factor 4 purified from human platelet releasate as the immunogen.Degré de pureté :Min. 95%Myc antibody
The Myc antibody is a monoclonal antibody that specifically targets the protein Myc. It belongs to the family of kinase inhibitors and is widely used in Life Sciences research. This antibody has shown high affinity for Myc, making it a valuable tool for studying the functions and interactions of this protein.
INSR antibody
The INSR antibody is a monoclonal antibody that targets the insulin receptor (INSR). It has been widely used in the field of Life Sciences for research purposes. This antibody specifically recognizes and binds to the INSR, allowing for the detection and analysis of this important protein.
Alkaline Phosphatase antibody
The Alkaline Phosphatase antibody is a monoclonal antibody that targets the alkaline phosphatase enzyme. It has been widely used in the field of Life Sciences for various applications. This antibody specifically binds to alkaline phosphatase and inhibits its activity, making it a valuable tool for studying the function of this enzyme.Caspase 9 antibody
The Caspase 9 antibody is a polyclonal antibody that specifically targets the caspase-9 protein. This antibody has been shown to have neutralizing properties and can effectively inhibit the activity of caspase-9. Caspase-9 plays a crucial role in apoptosis, or programmed cell death, by initiating the cascade of events that lead to cell death. By targeting caspase-9, this antibody can help regulate cell growth and survival.
IL1b antibody
The IL1b antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to interleukin 1 beta (IL-1β), a glycosylated glycoprotein involved in inflammatory responses. This antibody is widely used in studies related to autoimmune diseases, cancer, and immune system disorders.
Fascin 1 antibody
The Fascin 1 antibody is a highly specialized monoclonal antibody that targets and binds to the protein Fascin 1. Fascin 1 is involved in various cellular processes, including cell adhesion, migration, and cytoskeletal organization. This antibody has been extensively studied in Life Sciences research and has shown inhibitory properties against Fascin 1 activity.
NUDT18 antibody
NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF
Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.
Chicken RBC antibody
Chicken RBC antibody was raised in rabbit using chicken erythrocytes as the immunogen.
Degré de pureté :Min. 95%Goat anti Human IgG (H + L)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.
Degré de pureté :Min. 95%COL4A5 antibody
The COL4A5 antibody is a monoclonal antibody that specifically targets the collagen type IV alpha 5 chain. It can be used in various applications in Life Sciences research. This antibody has been shown to bind to collagen type IV and inhibit its activity, making it a valuable tool for studying the role of collagen in various cellular processes. Additionally, the COL4A5 antibody has been used in experiments involving creatine kinase activation and family kinase inhibition. Its efficacy has also been demonstrated in electrode-based assays. This antibody is highly specific and shows minimal cross-reactivity with other proteins. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the most suitable option for their experiments. The COL4A5 antibody is an essential tool for investigating the functions and mechanisms of collagen type IV and its associated pathways.
Degré de pureté :Min. 95%phospho MBP antibody
Phospho MBP antibody was raised in mouse using a sythetic peptide corresponding to the human myelin basic protein sequence phosphorylated at Thr98 and coupled to tuberculin as the immunogen.
TMPRSS4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp technique, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture. With its unique mechanisms of action and potent properties, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is
NOSIP antibody
The NOSIP antibody is a highly specialized antibody that targets endothelial growth factors. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the Life Sciences field. This antibody has been extensively tested and validated for its specificity and sensitivity.
ABI1 antibody
The ABI1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets and neutralizes the alpha-fetoprotein, c-myc, hemoglobin, protein, collagen, interferon-gamma (IFN-gamma), telomerase, fibronectin, and growth factor. This antibody is widely used in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA). Its high specificity and affinity make it an essential tool for studying the role of these proteins in different biological processes. Whether you are conducting basic research or exploring potential therapeutic targets, the ABI1 antibody will provide valuable insights into cellular functions and signaling pathways. Trust this reliable antibody to enhance your scientific discoveries and advance your understanding of complex biological systems.
VMAT2 antibody
The VMAT2 antibody is a highly specialized antibody that targets the vesicular monoamine transporter 2 (VMAT2). This transporter is responsible for packaging and transporting neurotransmitters such as dopamine, serotonin, and norepinephrine into synaptic vesicles. By targeting VMAT2, this antibody can modulate the release of these neurotransmitters, making it a valuable tool in neuroscience research.
Klotho Beta antibody
Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
Degré de pureté :Min. 95%LTBR antibody
The LTBR antibody is a highly effective tool in the field of Life Sciences. It specifically targets and inhibits the activity of glycoproteins involved in various cellular processes. This polyclonal antibody has been extensively studied and shown to have potent cytotoxic effects on activated cells. Additionally, it has been found to interfere with the p38 mitogen-activated protein kinase (MAPK) pathway, a key signaling pathway involved in cell proliferation and survival.
PDGFRB antibody
PDGFRB antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%GMPS antibody
GMPS antibody was raised using the middle region of GMPS corresponding to a region with amino acids VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
CD25 antibody
CD25 antibody is a monoclonal antibody that specifically targets CD25, a glycoprotein expressed on the surface of activated T cells. It is commonly used in research and clinical settings to study and treat conditions related to T cell activation, such as autoimmune diseases and certain types of cancer.
Annexin V antibody
The Annexin V antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the fatty acid-binding protein Annexin V, which plays a crucial role in various cellular processes. This antibody is commonly used in assays to detect and quantify Annexin V expression levels.
PPIF antibody
PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
E. coli antibody
E. coli antibody was raised in goat using a mixture of E. coli serotypes as the immunogen.
Degré de pureté :Min. 95%
