Anticorps primaires

Affinity purified Rabbit polyclonal DJA1 antibody

SLC7A11 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The EGFR antibody is a highly effective growth factor that targets the c-myc protein. It is available in both polyclonal and monoclonal forms, offering versatility in its applications. This cytotoxic antibody has been extensively studied and proven to be effective in various assays, including the inhibition of human chorionic gonadotropin (hCG) and anti-VEGF assays. The EGFR antibody specifically targets nuclear glycoproteins, making it an ideal choice for research involving inhibitors and other nuclear-related studies. With its high specificity and potency, this monoclonal antibody is a valuable tool for researchers in the field of molecular biology and beyond.

GALNTL2 antibody was raised in Rabbit using Human GALNTL2 as the immunogen

SITPEC antibody was raised in rabbit using the middle region of SITPEC as the immunogen

Donkey anti-rat IgG (H + L) (FITC) was raised in donkey using Rat IgG (H&L) as the immunogen.

Rat monoclonal MHC Class II antibody (biotin)

Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.

Rabbit polyclonal ST5 antibody

CBLB antibody was raised in Rabbit using Human CBLB as the immunogen

Perilipin (C terminal) antibody was raised in Guinea Pig using C-terminus of perilipin as the immunogen.

Mouse monoclonal CDK5 antibody (N-terminus)

Rabbit polyclonal CYP24A1 antibody

Rabbit polyclonal TADA3L antibody

Rabbit polyclonal LPHN2 antibody

LILRA4 antibody was raised in Rabbit using Human LILRA4 as the immunogen

ACTR1B antibody was raised in Rabbit using Human ACTR1B as the immunogen

Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT

Rabbit polyclonal TRIP10 antibody

BOLA1 antibody was raised in Rabbit using Human BOLA1 as the immunogen

The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.

Rabbit polyclonal ABL1 antibody (Tyr412)

BCAT2 antibody was raised in Rabbit using Human BCAT2 as the immunogen

NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL

Rabbit polyclonal WRKY27.1 antibody

The PGP9.5 antibody is a highly specific and sensitive tool used in life sciences research. It is a polyclonal antibody that targets the protein gene product 9.5 (PGP9.5), also known as ubiquitin carboxyl-terminal hydrolase L1 (UCHL1). This antibody recognizes and binds to PGP9.5, allowing for its detection and quantification in various biological samples.

COL6A1 antibody was raised in Rabbit using Human COL6A1 as the immunogen

The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.

Rabbit polyclonal PPT1 antibody

ZNF605 antibody was raised in rabbit using the N terminal of ZNF605 as the immunogen

QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL

MEA1 antibody was raised in Rabbit using Human MEA1 as the immunogen

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN

Rabbit polyclonal PEX1 antibody

The WAS antibody is a polyclonal antibody used in life sciences research. It specifically targets the antigen-binding domain of the Wiskott-Aldrich syndrome (WAS) protein. This antibody is commonly used to detect protein carbonyls and has been extensively validated for use in various experimental settings. The WAS antibody is available as both monoclonal and polyclonal preparations, with the polyclonal form being particularly useful for neutralizing experiments. It can be used in a range of applications, including Western blotting, immunohistochemistry, and immunofluorescence. Additionally, this antibody has shown potential in studies involving polypeptide expression, anti-dnp antibodies, growth factors, caspase-9 signaling pathways, cholinergic systems, and bioassays. Researchers can rely on the high quality and specificity of the WAS antibody to advance their scientific investigations.

KIF6 antibody was raised in Rabbit using Human KIF6 as the immunogen

CD8a antibody was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.

Mouse monoclonal Dengue NS1 antibody (Subtype 4). Supplied in PBS buffer with sodium azide

Desmoglein 2 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to bind to desmoglein 2, a protein that plays a critical role in cell-cell adhesion in epithelial tissues. This antibody can be immobilized on an electrode surface for use in biosensor applications or used in immunohistochemistry and Western blotting techniques.

CCNG1 antibody was raised in Rabbit using Human CCNG1 as the immunogen

PRKAR2A antibody was raised in rabbit using the middle region of PRKAR2A as the immunogen

Rabbit polyclonal CHRC1 antibody

Rabbit polyclonal USP12 antibody

The Biotin antibody is a polyclonal antibody that specifically binds to biotin. It has a high affinity for biotin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA. This antibody is commonly used in life sciences research to detect and visualize biotinylated molecules or to amplify signals in assays. It can also be used in conjunction with streptavidin-conjugated enzymes or fluorochromes for detection purposes. The Biotin antibody is highly specific and sensitive, making it an essential tool for researchers working with biotinylation techniques or studying the role of biotin in biological processes.

MORF4L1 antibody was raised in Rabbit using Human MORF4L1 as the immunogen

The GSTP1 antibody is a polyclonal antibody that specifically targets the glutathione S-transferase pi 1 (GSTP1) protein. This protein is an important member of the GST family, which plays a crucial role in detoxification processes within cells. The GSTP1 antibody is designed to recognize and bind to the GSTP1 protein, allowing for its detection and analysis in various biological samples.

Rabbit polyclonal CEB alpha antibody (Ser21)

The Bax antibody is a chemokine globulin that is used in Life Sciences for its antiviral properties. It contains neutralizing antibodies that bind to specific proteins and colony-stimulating factors, such as GM-CSF (granulocyte-macrophage colony-stimulating factor). This polyclonal antibody has been activated and is a potent growth factor. It is formulated with excipients to ensure stability and effectiveness. The Bax antibody is commonly used in research and diagnostic applications to study cellular processes and immune responses.

AGFG2 antibody was raised in Rabbit using Human AGFG2 as the immunogen

ASB12 antibody was raised using the C terminal of ASB12 corresponding to a region with amino acids DDKGIALLLQARATPRSLLSQVRLVVRRALCQAGQPQAINQLDIPPMLIS

Rabbit polyclonal HNRPH1 antibody (biotin)

TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Affinity purified Rabbit polyclonal HHEX antibody

TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.

Lgi2 antibody was raised in rabbit using the middle region of Lgi2 as the immunogen

The IgG1 antibody is a highly versatile and potent medicament that belongs to the class of antibodies. It is activated upon binding to specific antigens, leading to cytotoxic effects on target cells. IgG1 antibodies play a crucial role in the immune response by neutralizing pathogens and promoting phagocytosis. These antibodies are widely used in life sciences research, diagnostics, and therapeutic applications.

The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.

ZNF275 antibody was raised in rabbit using the N terminal of ZNF275 as the immunogen

Affinity purified Rabbit polyclonal PRPSAP2 antibody

Rabbit polyclonal GJC3 antibody

The GAPDH antibody is a highly specific monoclonal antibody that is used for various applications in the field of Life Sciences. This antibody has been extensively tested and validated using human serum samples, making it a reliable tool for research. It binds specifically to glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a key enzyme involved in glycolysis and other cellular processes.

BCL7B antibody was raised in Rabbit using Human BCL7B as the immunogen

Armenian Hamster monoclonal CD61 antibody (FITC)

Affinity purified Rabbit polyclonal TTC11 antibody

This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.

Affinity purified Rabbit polyclonal Interferon alpha 6 antibody

ZNF624 antibody was raised in rabbit using the middle region of ZNF624 as the immunogen

RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

Affinity purified Rabbit polyclonal SERPINI2 antibody

FERMT3 antibody was raised in Rabbit using Human FERMT3 as the immunogen

Pneumolysin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets pneumolysin, a protein produced by Streptococcus pneumoniae, which is responsible for causing pneumonia and other respiratory infections. This antibody has been shown to neutralize the activity of pneumolysin, preventing its damaging effects on host cells. Pneumolysin antibody can be used in various applications such as immunohistochemistry, ELISA, and Western blotting to study the role of pneumolysin in disease progression and to develop new therapeutic strategies. With its high specificity and affinity for pneumolysin, this antibody is a valuable tool for researchers in the field of infectious diseases.

EEF1A2 antibody was raised using the middle region of EEF1A2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP

Mouse monoclonal DNAJA2 antibody

The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development

HDAC2 antibody was raised in Rabbit using Human HDAC2 as the immunogen

Rabbit polyclonal SMARCAL1 antibody

Rabbit polyclonal RAF1 antibody (Ser301)

CSF2RA antibody was raised in Rabbit using Human CSF2RA as the immunogen

The PZP antibody is a monoclonal antibody that targets taxol and oncostatin, which are growth factors involved in various biological processes. This antibody specifically binds to the CD33 antigen, making it an effective tool for research and therapeutic applications. Monoclonal antibodies like the PZP antibody are widely used in the field of life sciences for their ability to selectively target and inhibit specific molecules or pathways. The PZP antibody can be used in hybridization experiments, as well as in the development of inhibitors or activators for CD33-related signaling pathways. It is a valuable tool for researchers studying annexin or collagen-related processes. Whether you're conducting basic research or developing new therapies, the PZP antibody is an essential component in your scientific toolkit.

FGD2 antibody was raised in Rabbit using Human FGD2 as the immunogen

The FANCA antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the FANCA protein, which plays a crucial role in DNA repair and maintenance. By binding to FANCA, this antibody inhibits its proteolytic activity, preventing it from degrading important cellular components.

ZNF660 antibody was raised in rabbit using the C terminal of ZNF660 as the immunogen

The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.

Affinity purified Rabbit polyclonal CLC5 antibody

STK11 antibody was raised in rabbit using the C terminal of STK11 as the immunogen

G6pc antibody was raised in rabbit using the N terminal of G6pc as the immunogen

The Fenitrothion antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to fenitrothion, a commonly used organophosphate insecticide. This antibody can be utilized for various applications, including immunoassays, Western blotting, and immunohistochemistry.