Anticorps primaires

Rabbit polyclonal CYP24A1 antibody

VCAM1 antibody was raised in Mouse using a purified recombinant fragment of human VCAM1 expressed in E. coli as the immunogen.

The Aggrecan antibody is a highly effective neutralizing agent used in the field of Life Sciences. This antibody is specifically designed to target and inhibit the activity of aggrecan, a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential applications in mesenchymal stem cell research, as well as its ability to modulate TGF-beta signaling pathways.

R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

The SOD2 antibody is a polyclonal antibody that specifically targets the superoxide dismutase 2 (SOD2) protein. This antibody is commonly used in life sciences research to study the role of SOD2 in various cellular processes.

ZNF419A antibody was raised in rabbit using the C terminal of ZNF419A as the immunogen

Purified Rabbit polyclonal OR5AS1 antibody

The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.

ATP6V1A antibody was raised in Rabbit using Human ATP6V1A as the immunogen

LOC344065 antibody was raised in rabbit using the middle region of LOC344065 as the immunogen

Affinity purified Rabbit polyclonal FSD2 antibody

GOSR2 antibody was raised in Rabbit using Human GOSR2 as the immunogen

Rabbit polyclonal BAI1 antibody

The PPM1B antibody is a monoclonal antibody that targets the phosphatase enzyme PPM1B. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically recognizes and binds to PPM1B, inhibiting its activity and preventing its interaction with other molecules.

PGK2 antibody was raised using the C terminal of PGK2 corresponding to a region with amino acids ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM

Affinity purified Rabbit polyclonal ZNF707 antibody

The MTA1 antibody is a highly specific monoclonal antibody that targets the MTA1 protein. It is commonly used in life sciences research to study various cellular processes and pathways. The MTA1 protein plays a crucial role in gene regulation and has been implicated in cancer progression and metastasis.

ATP11B antibody was raised in Rabbit using Human ATP11B as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the class of rifamycins. It is specifically designed to target tuberculosis infection and contains active compounds known for their potent bactericidal activity. The key mechanism of action involves binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes, confirming its high efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also exhibits specific binding to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Affinity purified Rabbit polyclonal Lamin A/C antibody

Affinity purified Rabbit polyclonal DPRP1 antibody

Goat anti-rat IgM (FITC) was raised in goat using rat IgM mu chain as the immunogen.

Rabbit polyclonal HNRPH1 antibody (biotin)

Affinity purified Rabbit polyclonal ULK2 antibody

Rabbit polyclonal BIK antibody (Thr33)

The CD277 antibody is a protein that belongs to the class of autoantibodies. It is commonly used in Life Sciences research for its ability to detect and target specific proteins. The CD277 antibody has been shown to have neutralizing effects on various growth factors, such as TGF-beta1, fibronectin, and collagen. Additionally, it has been used in studies involving monoclonal antibodies like trastuzumab and interferon. The CD277 antibody is highly effective in detecting and blocking the activity of TGF-β1, making it an essential tool in research related to protein function and regulation.

RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY

TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM

Fractalkine antibody is an antigen-specific antibody that targets the chemokine known as fractalkine. It is commonly used in Life Sciences research and is available in both polyclonal and monoclonal forms. This antibody has the ability to bind to fractalkine, leading to lysis or cross-linking of the target molecule. The activated antibody can also be used as a neutralizing agent against extracellular polysaccharides. Fractalkine antibody is widely used in various applications, including immunohistochemistry, flow cytometry, and Western blotting, to study the role of fractalkine in different biological processes. With its high specificity and affinity for fractalkine, this antibody provides researchers with a valuable tool for investigating the functions and mechanisms of this important chemokine in various contexts.

Rabbit polyclonal NNT antibody

UBE2L6 antibody was raised using the N terminal of UBE2L6 corresponding to a region with amino acids LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL

Affinity purified Rabbit polyclonal Caspase 4 antibody

The MBP antibody is a monoclonal antibody that targets β-catenin, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of β-catenin. It can be used for immunohistochemistry, western blotting, and other experimental techniques.

Rabbit polyclonal elF4E antibody (Ser209)

Affinity purified Rabbit polyclonal TAAR5 antibody

Rabbit polyclonal SNRPD3 antibody

HMG20A antibody was raised in Rabbit using Human HMG20A as the immunogen

ABHD14A antibody was raised in Rabbit using Human ABHD14A as the immunogen

Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.

Affinity purified Mouse polyclonal HSD17B2 antibody

The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.

The TUB antibody is a monoclonal antibody that specifically targets the nuclear protein known as TUB. This antibody has been extensively tested and is proven to be highly effective in detecting TUB in human serum and MCF-7 cells. TUB is a crucial protein involved in various cellular processes, including hormone peptide synthesis, glucagon regulation, and tyrosine metabolism. Additionally, this antibody can be used in research applications such as immunohistochemistry and western blotting. Its high specificity and sensitivity make it a valuable tool for studying TUB-related diseases and exploring potential therapeutic interventions. Furthermore, the TUB antibody can be used in combination with other antibodies, such as anti-CD20 antibodies or alpha-fetoprotein antibodies, to enhance its detection capabilities. With its wide range of applications and reliable performance, the TUB antibody is an essential tool for researchers studying proteins involved in cellular signaling pathways, glycoprotein synthesis, amyloid plaque formation, and chemokine regulation.

Mouse monoclonal CD19 antibody (PE)

Goat anti-human lambda chain (biotin) was raised in goat using human l lambda chain as the immunogen.

Affinity purified Rabbit polyclonal SEPT7 antibody

CD4 antibody (PE) was raised in mouse using feline CD4 as the immunogen.

The INSR antibody is a monoclonal antibody that targets the insulin receptor (INSR). It has been widely used in the field of Life Sciences for research purposes. This antibody specifically recognizes and binds to the INSR, allowing for the detection and analysis of this important protein.

The PLVAP antibody is a glycopeptide that belongs to the class of antibodies used in Life Sciences. It is specifically designed to target and bind to PLVAP (Plasmalemma Vesicle-Associated Protein), an important protein involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.

Goat anti-monkey IgG (FITC) was raised in goat using monkey IgG as the immunogen.

Armenian Hamster monoclonal CD61 antibody (FITC)

Mouse IgE antibody was raised in rat using murine IgE as the immunogen.

The IL1b antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to interleukin 1 beta (IL-1β), a glycosylated glycoprotein involved in inflammatory responses. This antibody is widely used in studies related to autoimmune diseases, cancer, and immune system disorders.

The CDKL3 antibody is a cytotoxic monoclonal antibody that targets the oncostatin growth factor. It is commonly used in Life Sciences research to study the role of CDKL3 in various cellular processes. This antibody specifically binds to CDKL3, a protein involved in cell proliferation and differentiation. It has been shown to inhibit the growth of cancer cells by blocking the signaling pathway mediated by CDKL3. Additionally, the CDKL3 antibody has been used in hybridization studies to detect the expression of CDKL3 in different tissues and cell types. Its specificity and high affinity make it a valuable tool for researchers studying the function of CDKL3 and its potential as a therapeutic target for cancer treatment.

The PLXDC1 antibody is a powerful tool in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has been extensively studied for its role in endothelial growth and angiogenesis. This antibody specifically targets PLXDC1, a receptor that plays a crucial role in regulating the growth and development of blood vessels.

CHRNA6 antibody was raised in Rabbit using Human CHRNA6 as the immunogen

Rabbit polyclonal CDK1 antibody (Tyr15)

The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.

Affinity purified Rabbit polyclonal MTMR9 antibody

The Progesterone receptor antibody is a highly specific monoclonal antibody that targets the progesterone receptor. It is designed to bind to the receptor and inhibit its activity, making it an essential tool for studying the role of progesterone in various biological processes.

The CTNNB1 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the CTNNB1 protein, also known as beta-catenin, which plays a crucial role in cell adhesion and signaling pathways. This antibody is produced using advanced techniques and has been extensively validated for its specificity and sensitivity.

Affinity purified Rabbit polyclonal MAP2K3 antibody

Affinity purified Rabbit polyclonal Calpain 5 antibody

LDHAL6A antibody was raised in Rabbit using Human LDHAL6A as the immunogen

Affinity purified Rabbit polyclonal EPM2AIP1 antibody

C17ORF39 antibody was raised using the C terminal Of C17Orf39 corresponding to a region with amino acids SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR

LBR antibody was raised in Rabbit using Human LBR as the immunogen

The SH3BGRL3 antibody is a theranostic tool used in the field of Life Sciences. It plays a crucial role in various biological processes and has been extensively studied for its potential therapeutic applications. This antibody specifically targets SH3BGRL3, a proline-rich protein involved in cytokine receptor signaling and caveolin-1 regulation.

IDH3A antibody was raised in Rabbit using Human IDH3A as the immunogen

Mouse monoclonal GBP2 antibody

MMACHC antibody was raised in rabbit using the C terminal of MMACHC as the immunogen

Affinity purified Rabbit polyclonal ZNF165 antibody

Affinity purified Rabbit polyclonal alpha Tubulin 1A antibody

BAG5 antibody was raised in rabbit using the C terminal of BAG5 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

CKMT1A antibody was raised in Rabbit using Human CKMT1A as the immunogen

Affinity purified Rabbit polyclonal PODXL2 antibody

CBLN2 antibody was raised in Rabbit using Human CBLN2 as the immunogen

Rabbit polyclonal GPR161 antibody

Rabbit polyclonal AP2S1 antibody (HRP)

Rag1 antibody was raised in rabbit using the C terminal of Rag1 as the immunogen

Affinity purified Rabbit polyclonal SIAT4A antibody

CD40 antibody (PE) was raised in rat using CD40 as the immunogen

SLC25A45 antibody is a glycoprotein that belongs to the chemokine binding protein family. It plays a crucial role in various biological processes, including interferon signaling and hepatocyte growth regulation. This antibody is widely used in Life Sciences research for its ability to specifically bind to SLC25A45 and facilitate the detection and analysis of this protein. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The SLC25A45 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. Its high specificity and cytotoxic properties make it an essential tool for studying the function and expression of SLC25A45 in different cellular contexts.

The Angiopoietin 2 antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody designed to neutralize the activity of Angiopoietin 2, a glycoprotein involved in angiogenesis and vascular remodeling. This antibody has been extensively tested and proven to be highly specific and effective in blocking the interaction between Angiopoietin 2 and its receptor, thereby inhibiting angiogenesis.

CSNK1G1 antibody was raised in rabbit using the middle region of CSNK1G1 as the immunogen

Rabbit polyclonal TADA3 antibody (HRP)

Purified Polyclonal THRB antibody

Affinity purified Rabbit polyclonal TOK1 alpha antibody

TGF beta 1 antibody was raised in mouse using highly pure recombinant human TGF-beta1 as the immunogen.

GALE antibody was raised in Rabbit using Human GALE as the immunogen