Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.709 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(738 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75327 produits trouvés pour "Anticorps primaires"
Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a highly specific antibody that binds to tyrosine hydroxylase, an enzyme involved in the synthesis of neurotransmitters such as dopamine and norepinephrine. This antibody is widely used in Life Sciences research to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.
VEGFR2 antibody
The VEGFR2 antibody is a powerful tool in the field of Life Sciences. It specifically targets and inhibits endothelial growth, making it an essential component in studying angiogenesis and vascular development. This antibody is commonly used in research related to insulin signaling, as it can effectively block the activity of insulin and its receptors. Additionally, it has been shown to have inhibitory effects on nuclear receptors, such as the anti-HER2 antibody, which plays a crucial role in breast cancer treatment. Furthermore, the VEGFR2 antibody has been found to interfere with epidermal growth factor (EGF) signaling pathways, impacting cell growth and differentiation. Its acidic properties make it suitable for use in various laboratory techniques, including immunohistochemistry and Western blotting. With its broad range of applications and proven efficacy, the VEGFR2 antibody is a valuable asset for researchers seeking to unravel the complexities of cellular growth and development.
ESD antibody
ESD antibody was raised using the N terminal of ESD corresponding to a region with amino acids MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
ACO2 antibody
ACO2 antibody was raised using the N terminal of ACO2 corresponding to a region with amino acids LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATA
Plasminogen antibody
Plasminogen antibody was raised in sheep using human plasminogen purified from plasma as the immunogen.
Lp-PLA2 monoclonal antibody
Lp-PLA2 monoclonal antibody is a highly specialized antibody used in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Lp-PLA2, an enzyme involved in the inflammation process. By binding to Lp-PLA2, this antibody helps to inhibit its activity, reducing inflammation levels in the body.
MAP4K1 antibody
MAP4K1 antibody was raised using the N terminal of MAP4K1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK
DSG2 antibody
The DSG2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to a specific antigen, which plays a crucial role in cell growth and development. This antibody has been extensively tested and proven to be effective in inhibiting the activity of growth factors, thereby preventing the proliferation of certain cells.
EGLN3 antibody
EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT
NMDAR1 antibody
The NMDAR1 antibody is a diagnostic reagent that belongs to the class of antibodies. It has excellent pharmacokinetic properties and is commonly used in Life Sciences research. The antibody is designed to specifically bind to NMDAR1, a biomolecule involved in various cellular processes such as synaptic plasticity and learning. It can be used for applications such as immunohistochemistry, Western blotting, and flow cytometry.
ADAMTS6 antibody
ADAMTS6 antibody was raised in rabbit using the C terminal of ADAMTS6 as the immunogen
RPS8 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting strong bactericidal activity. Through transcription-quantitative polymerase chain techniques, its high frequency of human activity has been verified. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, this drug binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Lamin A antibody
The Lamin A antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the molecule known as Lamin A. This antibody has been extensively tested and proven to be effective in neutralizing Lamin A, which plays a crucial role in various cellular processes.
CREB antibody
The CREB antibody is a highly effective tool for various applications in the field of Life Sciences. This polyclonal antibody is specifically designed to recognize and bind to the cAMP response element-binding protein (CREB), a transcription factor involved in regulating gene expression.
CHAC1 antibody
CHAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
Carbonic Anhydrase Vb antibody (Mitochondrial)
Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
HSP antibody
The HSP antibody is a monoclonal antibody that has pharmacokinetic properties. It is formulated using crystalline cellulose and human serum, making it highly effective in targeting specific biomolecules. This antibody has been shown to be particularly effective in treating choroidal neovascularization, a condition characterized by abnormal blood vessel growth in the eye. The HSP antibody works by neutralizing oxidative damage and preventing toxic effects on the retina. Additionally, this monoclonal antibody has shown promising results in combination with sorafenib, an inhibitor of epidermal growth factor receptors. With its potent therapeutic properties, the HSP antibody is a valuable tool in the field of life sciences and holds great potential for future medical advancements.
RIOK2 antibody
RIOK2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD
bRAF antibody
The bRAF antibody is a highly reactive and immobilizing antibody that is used in Life Sciences research. It is capable of neutralizing the binding proteins associated with bRAF, an important protein involved in cell signaling pathways. This antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence. The bRAF antibody has been shown to be effective in detecting the presence of bRAF in human serum samples and mesenchymal stem cells. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the best option for their specific needs. With its high specificity and affinity, the bRAF antibody provides accurate and reliable results for a wide range of experiments.
FBXO25 antibody
FBXO25 antibody was raised using the N terminal of FBXO25 corresponding to a region with amino acids LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL
Complexin 2 antibody
Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
PDLIM2 antibody
The PDLIM2 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. This antibody is specifically designed to target and bind to the PDLIM2 protein, which is an important regulator of cell growth and survival. By binding to PDLIM2, this antibody can effectively block its activity, leading to a disruption in the signaling pathways associated with cell growth and proliferation.
TGM4 antibody
The TGM4 antibody is a polyclonal antibody that is used in the field of Life Sciences. It is commonly used in research studies involving human serum and electrode analysis. This antibody specifically targets TGM4, a protein complex involved in various cellular processes. Additionally, the TGM4 antibody has been shown to have neutralizing effects on certain growth factors, such as human chorionic gonadotropin and endothelial growth factor. Furthermore, it has been found to bind to necrosis factor-related apoptosis-inducing ligand (TRAIL), suggesting its potential role in modulating cell death pathways. Whether you're conducting groundbreaking research or exploring new avenues in the field of Life Sciences, the TGM4 antibody can be a valuable tool for your experiments.
SOX5 antibody
SOX5 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 5
MARCKS antibody
The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.
HDAC3 antibody
The HDAC3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and detect HDAC3, a protein involved in various cellular processes. This antibody has been extensively validated and proven to be highly specific and sensitive in detecting HDAC3 levels.
GPR3 antibody
GPR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%RFESD antibody
RFESD antibody was raised using a synthetic peptide corresponding to a region with amino acids VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK
C9orf64 antibody
C9orf64 antibody was raised in rabbit using the C terminal of C9orf64 as the immunogen
TEK antibody
The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.
Tau antibody
Tau antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's and Parkinson's. This antibody binds to tau and neutralizes its harmful effects, preventing the formation of toxic tau aggregates. Additionally, Tau antibody has been shown to inhibit the activity of caspase-9, a key enzyme involved in apoptosis. This property makes it a potential therapeutic option for conditions associated with excessive cell death. Furthermore, studies have demonstrated that Tau antibody promotes the growth and differentiation of mesenchymal stem cells, making it a valuable tool in regenerative medicine research. With its high specificity and efficacy, this monoclonal antibody is an essential component in various scientific studies and biomedical applications.
Degré de pureté :Min. 95%Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
CD18 antibody (Azide Free)
CD18 antibody (Azide free) was raised in rat using cell membrane lysates derived from murine T cell lymphoma BW5147 as the immunogen.
p38 MAPK antibody
The p38 MAPK antibody is a highly effective tool used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the activity of p38 MAPK, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and reliability.
SPI1 antibody
The SPI1 antibody is a high-quality polyclonal antibody that specifically targets biomolecules involved in various biological processes. It has been extensively tested and validated for its specificity and reliability. This antibody shows excellent binding affinity towards tumor necrosis factor-alpha (TNF-α), interleukin-6 (IL-6), ornithine, monoclonal antibodies, haloperidol, mineralocorticoid receptor, teriparatide, dopamine, glycosylation, interferon, and other important proteins.
AML1 antibody
The AML1 antibody is a neutralizing insulin antibody that targets the growth factor adalimumab. It is a monoclonal antibody that specifically binds to glutamate and has been extensively studied in the field of Life Sciences. This antibody is commonly used in research for its ability to detect and measure various proteins, including rubisco, insulin, TNF-α, natriuretic peptides, and glycoproteins. With its high specificity and sensitivity, the AML1 antibody is an essential tool for scientists conducting experiments related to protein analysis and characterization.
Cip1 antibody
Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.
Degré de pureté :Min. 95%Chromogranin A antibody
Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids PVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF
RBM22 antibody
RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF
ARAF antibody
The ARAF antibody is a peptide receptor that is widely used in Life Sciences. It is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers. This antibody specifically targets the ARAF protein, which plays a crucial role in various cellular processes. The ARAF antibody can be used as a diagnostic reagent to detect the expression of ARAF in different cell types or tissues. Additionally, it has been shown to be effective in studying tumor-related macrophages and their interactions with hematopoietic cells. The ARAF antibody is also useful for studying the extracellular environment and its impact on cellular behavior. Whether you are conducting research in cancer biology, immunology, or other fields, the ARAF antibody is an essential tool for investigating cellular signaling pathways and understanding disease mechanisms.
PAR4 antibody
The PAR4 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Protease-Activated Receptor 4 (PAR4) in various biological processes. PAR4 plays a crucial role in cellular signaling pathways, particularly those involving epidermal growth factors and growth factors. By binding to PAR4, this antibody effectively inhibits its activation by proteases, preventing downstream effects such as the release of inflammatory cytokines and interferons.
ITGA6 antibody
The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.
CD154 antibody (FITC)
CD154 antibody (FITC) was raised in mouse using human sgp39 fusion protein as the immunogen.
Degré de pureté :Min. 95%MKK3 antibody
The MKK3 antibody is a highly specialized monoclonal antibody that targets the growth hormone receptor and progesterone. It is commonly used in immunoassays and research studies within the field of Life Sciences. This antibody specifically binds to MKK3, a phosphatase enzyme involved in various cellular processes such as chemokine signaling and interferon response. The MKK3 antibody has been extensively validated for its specificity and sensitivity in detecting activated MKK3 in human serum samples. Additionally, it can be utilized as a valuable tool for studying the role of MKK3 in different biological pathways and for developing potential inhibitors targeting this enzyme. With its high-quality performance, this polyclonal antibody is an essential component for any researcher working in the field of Life Sciences.
KLKB1 antibody
The KLKB1 antibody is a highly effective medicament used in the field of life sciences. It is widely recognized for its ability to detect and analyze colony-stimulating factors in blood plasma. This Polyclonal Antibody has shown remarkable results in various research studies, including electrochemical impedance spectroscopy and cytometry analysis. Its reactive properties make it an ideal tool for investigating messenger RNA expression and leukocyte antigen activity. Additionally, the KLKB1 antibody has demonstrated cytotoxic effects on target cells, making it a valuable asset in the study of cellular mechanisms. With its adeno-associated viral delivery system, this antibody offers a promising avenue for therapeutic applications.
LYN antibody
LYN antibody was raised using the N terminal of LYN corresponding to a region with amino acids DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
NOL6 antibody
NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR
EFNA5 antibody
The EFNA5 antibody is a highly specialized polyclonal antibody that targets EFNA5, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and neutralizing EFNA5 in different research applications.
FSH antibody
The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.
Degré de pureté :Min. 95%Troponin T Type 3 antibody
Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK
PRTFDC1 antibody
PRTFDC1 antibody was raised using the N terminal of PRTFDC1 corresponding to a region with amino acids AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD
