Anticorps primaires

<p>ITLN1 antibody was raised in rabbit using the middle region of ITLN1 as the immunogen</p>

<p>Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids  SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR</p>

<p>The BMP10 antibody is a highly specialized product used in Life Sciences research. It is designed to target and bind to the BMP10 protein, which plays a crucial role in the development and function of neonatal cardiac myocytes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.</p>

<p>Mouse monoclonal KDM4C antibody</p>

<p>The Vimentin antibody is a highly specific monoclonal antibody that targets the protein vimentin. Vimentin is an intermediate filament protein that plays a crucial role in maintaining the structural integrity of cells. This antibody has been widely used in various research fields, including Life Sciences and histidine studies.</p>

<p>Rabbit anti-bovine IgG (HRP) was raised in rabbit using bovine IgG F(ab')2 fragment as the immunogen.</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase crucial for regulating key cellular functions, including growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt/mTOR pathway, which integrates external signals to maintain cellular function and adaptation. Humans express three Akt isoforms—Akt1, Akt2, and Akt3—each encoded by a distinct gene. The activation of Akt generally starts when external signals like growth factors or insulin bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane, which attracts Akt to the membrane, where it undergoes phosphorylation at two specific sites, Thr308 and Ser473, to become fully active. Once activated, Akt moves through the cell to phosphorylate target proteins involved in various cellular pathways.The primary functions of Akt include promoting cell survival by inhibiting apoptosis through the inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also supports cell growth and proliferation by activating mTOR, a central regulator of protein synthesis, while suppressing growth-arrest pathways. Akt plays a key role in metabolic regulation by increasing glucose uptake and glycolysis, largely through GLUT4 translocation and hexokinase activation, which is particularly important in muscle and fat tissues. It contributes to angiogenesis by upregulating VEGF expression, aiding tissue growth and repair, and it promotes cell migration, facilitating wound healing as well as the spread of cancer cells in malignancy. Due to its broad role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor growth, which makes the PI3K/Akt/mTOR pathway a target for many cancer therapies. Additionally, Akt's role in glucose metabolism links it to insulin signaling, where defects can impair glucose uptake, leading to insulin resistance and type 2 diabetes.</p>

<p>Purified Rabbit polyclonal eEF1 alpha antibody</p>

<p>C16ORF65 antibody was raised using the middle region of C16Orf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI</p>

<p>The Histone H2B antibody is a highly specific monoclonal antibody that is derived from plasma. It is commonly used in Life Sciences research to study various cellular processes, including chromatin remodeling and gene expression regulation. This antibody has been shown to have high affinity and specificity for Histone H2B, a protein involved in DNA packaging within the cell nucleus.</p>

<p>The Frizzled 5 antibody is a highly specialized antibody that can be used in various life science research applications. It is available in both polyclonal and monoclonal forms, providing researchers with flexibility in their experiments.</p>

<p>FUS antibody was raised using the N terminal of FUS corresponding to a region with amino acids MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY</p>

<p>Plasminogen antibody was raised in sheep using human plasminogen purified from plasma as the immunogen.</p>

<p>Anti-Feline Leukemia Virus antibody</p>

<p>Rabbit polyclonal Seed G17 antibody</p>

<p>The KSR2 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to specific lysine residues on proteins, particularly β-catenin. This binding inhibits the formation of syncytia, which are large cell masses formed by the fusion of multiple cells. The KSR2 antibody is pegylated, meaning it has been modified with polyethylene glycol to enhance its stability and extend its half-life in the body.</p>

<p>HNRNPC antibody was raised using a synthetic peptide corresponding to a region with amino acids ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN</p>

<p>Mouse monoclonal CXorf26 antibody</p>

<p>Rabbit polyclonal PNCK antibody</p>

<p>Rabbit polyclonal NDUFA3 antibody</p>

<p>C13ORF31 antibody was raised using the middle region of C13Orf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The POT1 antibody is a growth factor that belongs to the class of Polyclonal Antibodies. It forms dimers with calmodulin and has cytotoxic properties. This antibody is widely used in Life Sciences research, particularly in studies related to epidermal growth factor. It can be used as a monoclonal antibody or in combination with other antibodies. The POT1 antibody has neutralizing effects on human serum and has been shown to inhibit the activity of electrode and gm-csf colony-stimulating factor. Furthermore, it has been found to have potential therapeutic applications in the treatment of autoimmune diseases associated with autoantibodies.</p>

<p>ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY</p>

<p>The ActA antibody is a monoclonal antibody used as a diagnostic reagent in the field of Life Sciences. It specifically binds to ActA, a protein found in human serum that is associated with choroidal neovascularization. This antibody has high affinity and specificity for ActA and can be used to detect its presence in samples. Additionally, the ActA antibody has been shown to have serum albumin binding properties, making it useful for various applications in biomolecule research. It does not exhibit any toxic effects or induce oxidative damage, ensuring its safety for use in laboratory settings. With its exceptional performance and reliability, the ActA antibody is an essential tool for researchers working in the field of Life Sciences.</p>

<p>NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG</p>

<p>MAP4K4 antibody was raised using the N terminal of MAP4K4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ</p>

<p>UBE2C antibody was raised using the N terminal of UBE2C corresponding to a region with amino acids ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS</p>

<p>The GAB2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including cation channel regulation and antigen-antibody reactions. This antibody specifically targets the activated form of platelet fibrinogen, which is essential for blood clotting.</p>

<p>Progesterone 11 alpha Monoclonal Antibody</p>

<p>Rabbit Polyclonal FKHR antibody (Ser256)</p>

<p>TBC1D21 antibody was raised using the N terminal of TBC1D21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC</p>

<p>Purified Polyclonal UBR2 antibody</p>

<p>Rabbit polyclonal GSTP1 antibody (FITC)</p>

<p>Rabbit polyclonal ZNF541 antibody</p>

<p>NCKAP1L antibody was raised in rabbit using the N terminal of NCKAP1L as the immunogen</p>

<p>phospho Kidins220 antibody was raised in rabbit using residues 907-923 [RQMQRTITRQMpS919FDLTK] of the human 220 kDa kidins220 protein as the immunogen.</p>

<p>FUBP3 antibody was raised in rabbit using the N terminal of FUBP3 as the immunogen</p>

<p>RELM beta antibody was raised in rabbit using highly pure recombinant murine RELMbeta as the immunogen.</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR</p>

<p>JMJD3 antibody was raised in rabbit using the N terminal of JMJD3 as the immunogen</p>

<p>CD152 antibody was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>Purified Polyclonal ATF7 antibody</p>

<p>OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV</p>

<p>OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogen</p>

<p>TMEM63A antibody was raised using the N terminal of TMEM63A corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP</p>

<p>Purified Polyclonal Nibrin antibody</p>

<p>Rabbit polyclonal RPL3 antibody</p>

<p>Rabbit polyclonal RBM9 antibody</p>

<p>HPS6 antibody was raised in Rabbit using Human HPS6 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting strong bactericidal activity. Through transcription-quantitative polymerase chain techniques, its high frequency of human activity has been verified. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, this drug binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>CLN6 antibody was raised using the C terminal of CLN6 corresponding to a region with amino acids RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA</p>

<p>SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen</p>

<p>Rabbit polyclonal Paxillin antibody (Ser272)</p>

<p>ANGPTL7 antibody was raised in rabbit using the middle region of ANGPTL7 as the immunogen</p>

<p>Sntg1 antibody was raised in rabbit using the N terminal of Sntg1 as the immunogen</p>

<p>Reck antibody was raised in rabbit using the middle region of Reck as the immunogen</p>

<p>KLRF1 antibody was raised using the middle region of KLRF1 corresponding to a region with amino acids QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK</p>

<p>NARF antibody was raised in rabbit using the middle region of NARF as the immunogen</p>

<p>VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL</p>

<p>ZNF791 antibody was raised in rabbit using the middle region of ZNF791 as the immunogen</p>

<p>Rabbit Polyclonal ADD1 antibody (Ser726)</p>

<p>Tyrp1 antibody was raised in rabbit using the C terminal of Tyrp1 as the immunogen</p>

<p>GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF</p>

<p>SLC11A2 antibody was raised using the N terminal Of Slc11A2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF</p>

<p>SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids  MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR</p>

<p>FOXR2 antibody was raised in rabbit using the N terminal of FOXR2 as the immunogen</p>

<p>The Lck antibody is a highly specific monoclonal antibody that targets the Lck protein, a tyrosine kinase involved in T-cell signaling. It is commonly used in research and diagnostic applications to study the role of Lck in various cellular processes. The Lck antibody recognizes a specific epitope on the Lck protein and can be used for immunoprecipitation, Western blotting, flow cytometry, and immunofluorescence experiments. This antibody has been extensively validated and shown to have high specificity and sensitivity. It is available as both a monoclonal antibody and a polyclonal antibody, allowing researchers to choose the best option for their specific needs. Whether you are studying T-cell activation, immune response, or signal transduction pathways, the Lck antibody is an essential tool for your research. Trust in its quality and reliability to advance your understanding of cellular biology.</p>

<p>Rabbit polyclonal AFX antibody</p>

<p>FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL</p>

<p>The Vimentin antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets vimentin, an intermediate filament protein found in various cell types. It has been extensively used to study the expression and localization of vimentin in different tissues and cell lines.</p>

<p>Mouse monoclonal TPSG1 antibody</p>

<p>SLC1A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAI</p>

<p>Purified Polyclonal CD246 antibody</p>

<p>The NCOA4 antibody is a highly specialized polyclonal antibody that targets a specific antigen. It can be used in various applications, including research in the field of Life Sciences, development of vaccines, and production of monoclonal antibodies. This antibody has shown promising results in the treatment of various diseases, including cancer. It has been found to have anticancer properties and can be used as a potential therapeutic agent. Additionally, the NCOA4 antibody has been studied for its ability to inhibit retinoid metabolism, making it a valuable tool in the development of retinoid-based medicines. Its unique mechanism of action involves targeting specific molecules such as β-catenin and HDAC inhibitor, which are known to play crucial roles in disease progression. With its wide range of applications and potential therapeutic benefits, the NCOA4 antibody is a valuable asset in the field of biomedical research and drug discovery.</p>

<p>FZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV</p>

<p>TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG</p>

<p>TPD52 antibody was raised in rabbit using the C terminal of TPD52 as the immunogen</p>

<p>Please enquire for more information about Affinity Purified anti-COVID-19 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Polyclonal NIP7 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>

<p>FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV</p>

<p>MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP</p>

<p>Purified Polyclonal BCAS2 antibody</p>

<p>MSI1 antibody was raised in rabbit using residues 5-21 [APQPGLASPDSPHDPCK] of the human mushashi protein as the immunogen.</p>

<p>Purified Polyclonal AMPK alpha 1 antibody</p>

<p>The HSL antibody is a highly specialized monoclonal antibody that targets and interacts with nuclear proteins involved in various cellular processes. It is commonly used in life sciences research, particularly in studies related to hybridization and the identification of inhibitors. Additionally, the HSL antibody has been found to be effective against specific markers such as CD33 and osteopontin. This versatile antibody can also be utilized for its cytotoxic properties, making it a valuable tool in cancer research. With its ability to recognize and bind to activated proteins like oncostatin, taxol, and β-catenin, the HSL antibody offers researchers a powerful means of studying cellular pathways and mechanisms.</p>

<p>The ENDOG antibody is a highly potent cytotoxic monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to annexin, an important protein involved in endothelial growth. By binding to annexin, the ENDOG antibody inhibits the growth and proliferation of endothelial cells, making it a valuable tool for studying angiogenesis and tumor development. Additionally, this antibody has shown promising results in interfering with various cellular processes, including interferon signaling and lipoprotein lipase activity. With its high specificity and affinity for its target, the ENDOG antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>Rabbit polyclonal CYP2C18 antibody</p>

<p>CHEK2 antibody was raised in rabbit using the N terminal of CHEK2 as the immunogen</p>

<p>RELT antibody is a monoclonal antibody that specifically targets ferritin, a protein involved in iron homeostasis. This antibody has been shown to inhibit oxidative damage caused by ferritin and prevent the accumulation of iron in cells. In addition, RELT antibody has shown potential therapeutic effects against various diseases, including influenza hemagglutinin and fibrinogen-related disorders. It has also been found to inhibit the growth of hepatocyte growth factor-dependent tumors. This monoclonal antibody derivative works by binding to specific epitopes on ferritin and blocking its activity. By targeting ferritin at the molecular level, RELT antibody offers a promising approach for the development of targeted therapies in Life Sciences.</p>

<p>BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN</p>

<p>Nucleolin antibody was raised using the N terminal of NCL corresponding to a region with amino acids GKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDED</p>

<p>ZMYND17 antibody was raised in rabbit using the C terminal of ZMYND17 as the immunogen</p>

<p>Purified Rabbit polyclonal MADS4 antibody</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>