Anticorps primaires

<p>Rabbit polyclonal KAD5 antibody</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Purified Polyclonal TCP1 zeta antibody</p>

<p>HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.</p>

<p>Mouse monoclonal FZE3 antibody</p>

<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>

<p>The NP antibody is a monoclonal antibody that specifically targets antiphospholipid antibodies. It is designed to recognize and bind to glycopeptides and glycoproteins associated with these autoantibodies. The NP antibody has cytotoxic properties and can be used for various applications in research and diagnostics.</p>

<p>KIF13B antibody was raised using the N terminal of KIF13B corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE</p>

<p>Mouse monoclonal N-acetyltransferase antibody</p>

<p>Rabbit Polyclonal eIF2 alpha antibody (Ser49)</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV</p>

<p>SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids  GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH</p>

<p>Rabbit polyclonal ARPP21 antibody</p>

<p>Mouse monoclonal FBXO21 antibody</p>

<p>The LANCL1 antibody is a basic protein that plays a crucial role in various biological processes. It is commonly used in Life Sciences research to study the function and interactions of LANCL1. This antibody has shown promising results in studies involving collagen synthesis and its regulation. Additionally, it has been used in experiments investigating the effects of imatinib on LANCL1 activity. The LANCL1 antibody is known for its high specificity and sensitivity, making it an excellent tool for detecting LANCL1 levels in samples. Researchers have also utilized this antibody to detect autoantibodies, such as antiphospholipid antibodies, and explore their potential implications in disease development. Furthermore, this polyclonal antibody has been employed to examine the role of LANCL1 in steroid and glucagon signaling pathways. Overall, the LANCL1 antibody offers valuable insights into the functions and mechanisms associated with this protein, making it an essential tool for researchers in various fields of study.</p>

<p>Rabbit polyclonal TPD54 antibody</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY</p>

<p>Anti-Human CD25 Monoclonal Antibody</p>

<p>Rabbit polyclonal Spermidine synthase antibody (HRP)</p>

<p>Armenian Hamster monoclonal CD103 antibody (biotin)</p>

<p>Rabbit Polyclonal Fyn antibody (Tyr530)</p>

<p>Rabbit polyclonal RAB9A antibody</p>

<p>Purified Polyclonal Kalirin antibody</p>

<p>Rabbit Polyclonal SOX9 antibody (Ser181)</p>

<p>Rabbit polyclonal TRAP1 antibody</p>

<p>CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG</p>

<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>

<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI</p>

<p>The CPA1 antibody is a monoclonal antibody that specifically targets the CPA1 enzyme. This antibody has been extensively studied for its protease activity and its potential applications in the field of life sciences. It has been shown to effectively inhibit the activity of CPA1, which plays a crucial role in various physiological processes.</p>

<p>The HDAC2 Antibody is a highly effective tool for studying the role of histone deacetylase 2 (HDAC2) in various cellular processes. This antibody specifically targets HDAC2, a key enzyme involved in the regulation of gene expression through the modification of histone proteins. By binding to HDAC2, this antibody allows for the detection and quantification of HDAC2 levels in cells and tissues.</p>

<p>Rabbit polyclonal CARD10 antibody</p>

<p>WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Rabbit polyclonal PDCD1 antibody</p>

<p>FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV</p>

<p>Human Haptoglobin Reference Serum</p>

<p>Purified Rabbit polyclonal MADS91 antibody</p>

<p>Rabbit polyclonal PARP15 antibody</p>

<p>Mouse monoclonal anti human GARS antibody</p>

<p>Please enquire for more information about Affinity Purified anti-COVID-19 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>BRS3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified Polyclonal PSMC6 antibody</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW</p>

<p>Rabbit polyclonal EPHB6 antibody</p>

<p>Rabbit polyclonal CXCL10 antibody (FITC)</p>

<p>The BCLXL antibody is a neutralizing agent commonly used in Life Sciences research. This antibody specifically targets the BCLXL protein, which is involved in regulating cell survival and apoptosis. By binding to BCLXL, this antibody can inhibit its activity and potentially induce cell death in certain conditions.</p>

<p>TMEM146 antibody was raised using the N terminal of TMEM146 corresponding to a region with amino acids LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF</p>

<p>EIF3C antibody was raised in Rabbit using Human EIF3C as the immunogen</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>MAOA antibody was raised in Rabbit using Human MAOA as the immunogen</p>

<p>The DCT antibody is a polyclonal antibody that specifically targets actin filaments. It is commonly used in Life Sciences research to study the activation and function of actin in various cellular processes. This antibody can be used for immunostaining, Western blotting, and other experimental techniques to visualize and quantify actin levels in cells and tissues.</p>

<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>

<p>CRP antibody was raised in mouse using human CRP as the immunogen.</p>

<p>OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogen</p>

<p>Rabbit polyclonal ELMOD2 antibody</p>

<p>LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>

<p>Rabbit polyclonal KCNC4 antibody</p>

<p>Rabbit polyclonal TRIM3 antibody</p>

<p>Rabbit polyclonal Chicken Serum Albumin antibody (biotin)</p>

<p>SPTLC2 antibody was raised using the N terminal of SPTLC2 corresponding to a region with amino acids VLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENF</p>

<p>ST14 antibody is a monoclonal antibody that targets protein kinase ST14. It is widely used in Life Sciences research for its ability to specifically bind to ST14 and inhibit its activity. This antibody has been shown to effectively block the function of ST14, preventing its interaction with other proteins and interfering with various cellular processes. Additionally, ST14 antibody has been used in studies involving albumin, inhibitors, antibodies, tyrosine, alpha-synuclein, activated mitogen-activated protein (MAP) kinases, collagen, and glucose transporter. It is also known to enhance the cytotoxic effects of certain anti-CD20 antibodies. With its high specificity and potency, ST14 antibody is a valuable tool for scientists studying protein kinase signaling pathways and their role in disease development and progression.</p>

<p>AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE</p>

<p>Rabbit polyclonal CHRM4 antibody</p>

<p>The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.</p>

<p>The HSP27 antibody is a highly specialized product used in the field of life sciences. It is an activated growth factor that plays a crucial role in various cellular processes. This antibody specifically targets HSP27, a protein involved in the regulation of cell growth and survival.</p>

<p>The N cadherin antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes such as cell adhesion, differentiation, and migration. This antibody specifically targets N cadherin, a protein that is involved in cell-cell adhesion and signaling.</p>

<p>Rabbit polyclonal ROBO3 antibody</p>

<p>The AKT1 antibody is a powerful tool used in Life Sciences research. This antibody specifically targets the AKT1 protein, which plays a crucial role in cell growth, survival, and metabolism. By binding to AKT1, this antibody can effectively block its activity and inhibit downstream signaling pathways.</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>Purified Polyclonal Alpha actin 3 antibody</p>

<p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

<p>Rabbit polyclonal TMCO6 antibody</p>

<p>The STAT2 antibody is a polyclonal antibody that targets the STAT2 molecule. It is commonly used in research and assays related to androgen signaling, low-density lipoprotein metabolism, autoantibodies, and inhibitors. This antibody has been shown to be effective in detecting and quantifying STAT2 expression in various cell types, including MCF-7 cells. In addition, it is widely used in life sciences research to study the regulation of cortisol concentration and the role of STAT2 in immune responses. The STAT2 antibody is a valuable tool for researchers looking to investigate the function and activation of this important signaling molecule.</p>

<p>Rabbit Polyclonal PPP1R2 antibody (Ser120+Ser121)</p>

<p>The Peanut Protein Antibody is a monoclonal antibody that specifically targets peanut proteins. It is commonly used in the field of Life Sciences for various applications such as immunoassays and transcription-polymerase chain reaction (PCR). This antibody is highly sensitive and can detect even trace amounts of peanut protein in samples. It utilizes a particle chemiluminescence method to provide accurate and reliable results. The Peanut Protein Antibody has been extensively validated and proven to be reactive against a wide range of peanut proteins, making it an essential tool for researchers studying peanut allergies and related conditions. Additionally, this antibody has shown neutralizing activity against the allergenic properties of peanuts, making it a potential candidate for therapeutic applications. With its high specificity and sensitivity, the Peanut Protein Antibody is an indispensable tool for anyone working with peanut proteins in research or diagnostic settings.</p>

<p>Mouse monoclonal UBOX5 antibody</p>

<p>GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW</p>

<p>CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS</p>

<p>The PTPN2 antibody is a highly specialized antibody used in the field of Life Sciences. It is available as both a monoclonal and polyclonal antibody. This antibody specifically targets and binds to the PTPN2 protein, which plays a crucial role in various biological processes.</p>

<p>Mapk12 antibody was raised in rabbit using the C terminal of Mapk12 as the immunogen</p>

<p>MCM5 antibody was raised in Rabbit using Human MCM5 as the immunogen</p>

<p>ITPKA antibody was raised in Rabbit using Human ITPKA as the immunogen</p>

<p>The Cytochrome P450 2D6 antibody is a polyclonal antibody that specifically targets and binds to the cytochrome P450 2D6 enzyme. This enzyme plays a crucial role in drug metabolism, particularly in the metabolism of many commonly prescribed medications. The antibody recognizes the specific amino acid sequence of the cytochrome P450 2D6 enzyme and can be used for various applications in life sciences research.</p>

<p>Rabbit polyclonal NRSN2 antibody</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL</p>

<p>Rabbit polyclonal TUBA1A antibody</p>

<p>The SOX10 antibody is a growth factor that plays a crucial role in various biological processes. It interacts with fibronectin and calpain, and its activity can be modulated by substances such as taxol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different research areas.</p>

<p>Rabbit polyclonal RRAS antibody</p>

<p>Rabbit polyclonal ZNHIT1 antibody</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen</p>

<p>The RBP4 antibody is a highly specialized antibody that can be used for various applications. It is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. This antibody specifically targets retinol-binding protein 4 (RBP4), which plays a crucial role in the transport of retinol (vitamin A) in human serum.</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant rat TNF-alpha as the immunogen.</p>