Anticorps primaires

<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>

<p>Purified Polyclonal RAB35 antibody</p>

<p>Purified Rabbit polyclonal MADS91 antibody</p>

<p>This Monoclonal anti-Testosterone antibody is suitable for ELISA and LFD applications.</p>

<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>

<p>Rabbit polyclonal PPP3CA antibody</p>

<p>DHRS2 antibody was raised in Rabbit using Human DHRS2 as the immunogen</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>Purified Polyclonal Caspase 14 p10 antibody</p>

<p>Rabbit polyclonal PFDN4 antibody</p>

<p>Goat anti Human IgE antibody</p>

<p>Rabbit polyclonal LAMB1 antibody</p>

<p>Rabbit polyclonal TRIM3 antibody</p>

<p>Rabbit polyclonal TMCO6 antibody</p>

<p>Please enquire for more information about Affinity Purified anti-Digoxigenin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ZNF264 antibody was raised in rabbit using the C terminal of ZNF264 as the immunogen</p>

<p>Rabbit polyclonal SRGAP3 antibody</p>

<p>Rabbit polyclonal PRDM12 antibody</p>

<p>Purified Polyclonal Alpha actin 3 antibody</p>

<p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>

<p>Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.</p>

<p>Goats were immunized with highly purified cat IgG h+l and the resulting antiserum was collected. Specific antibody was immunoaffinity purified off a cat IgG containing immunosorbent. Antibody concentration was determined using an absorbance at 280 nm: 1.4 equals 1.0 mg of IgG.<br>This antibody will react with cat IgG and with light chains common with other cat immunoglobulins as determined by ELISA and IEP techniques. It is suitable for blotting, ELISA, IHC and Lateral Flow applications. This antibody may crossreact with IgG from other species. Optimal working dilutions should be determined experimentally by the investigator.</p>

<p>Rabbit Polyclonal PPP1R2 antibody (Ser120+Ser121)</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Rabbit polyclonal NRSN2 antibody</p>

<p>COG5 antibody was raised in rabbit using the N terminal of COG5 as the immunogen</p>