Anticorps primaires

Rabbit polyclonal PLA2G4F antibody

Rabbit polyclonal STATH antibody

Rabbit polyclonal UNKL antibody

Affinity purified Rabbit polyclonal DNAI2 antibody

The RANKL antibody is a monoclonal antibody that targets the receptor activator of nuclear factor-kappa B ligand (RANKL). It is used in the field of life sciences to study various biological processes, including microvessel density and growth factor signaling. The RANKL antibody has been shown to have an acidic pH optimum and can be used in combination with other antibodies such as adalimumab or anticoagulants for research purposes. This antibody is commonly used in immunohistochemistry and Western blotting techniques to detect the presence of RANKL in different tissues or cell types. It has also been used in studies investigating the role of RANKL in diseases such as osteoporosis, cancer, and multidrug resistance.

ARSA antibody was raised in Rabbit using Human ARSA as the immunogen

IL16 antibody was raised in Rabbit using Human IL16 as the immunogen

Collagen Type VI Alpha 2 antibody was raised using the C terminal of COL6A2 corresponding to a region with amino acids ARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAI

HSPA8 antibody was raised in Rabbit using Human HSPA8 as the immunogen

The BTN3A2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets the BTN3A2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting the presence of BTN3A2.

The BRAF antibody is a powerful tool in the field of Life Sciences. It is an inhibitor that specifically targets BRAF, a protein involved in cell growth and division. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer.

Rabbit polyclonal RNR antibody (HRP)

Rabbit polyclonal MPZ antibody (FITC)

IMMP2L antibody was raised in rabbit using the C terminal of IMMP2L as the immunogen

Mouse monoclonal NIT2 antibody

Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.

EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

The GRK6 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying 3-kinase signaling pathways and related processes. This polyclonal antibody specifically targets and binds to GRK6, a key enzyme involved in signal transduction.

COG3 antibody was raised in Rabbit using Human COG3 as the immunogen

SYTL1 antibody was raised in rabbit using the N terminal of SYTL1 as the immunogen

Purified Polyclonal Caspase 1 p20 antibody

Rabbit polyclonal HOXC6 antibody

The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.

Rabbit polyclonal OR4F4 antibody

Rat monoclonal CD4 antibody (biotin); mouse target; IgG2b kappa; clone GK1.5

The p73 antibody is a highly effective and versatile tool in the field of Life Sciences. This colloidal, activated antibody is known for its exceptional inhibitory properties against interleukin-6 (IL-6), a key pro-inflammatory cytokine. By neutralizing IL-6, the p73 antibody helps regulate immune responses and reduce inflammation.

CCNL2 antibody was raised in Rabbit using Human CCNL2 as the immunogen

Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.

Rabbit polyclonal T3JAM antibody

The AMPD1 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets and detects AMPD1, an enzyme involved in fatty acid metabolism. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.

Mouse monoclonal SHPRH antibody

The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.

Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.

The JAK1 antibody is a highly effective chemokine inhibitor that has cytotoxic properties. It works by binding to the glucagon acid complex, preventing the activation of receptors and inhibiting cell signaling. This monoclonal antibody is specifically designed to target JAK1, a key protein involved in immune response and inflammation. By blocking the receptor binding, it prevents the release of pro-inflammatory cytokines and reduces inflammation in various tissues. The JAK1 antibody is widely used in life sciences research and has shown promising results in treating autoimmune diseases and certain types of cancer. Its high specificity and affinity make it an excellent tool for studying protein-protein interactions and developing targeted therapies.

UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

KRT8 antibody was raised in Rabbit using Human KRT8 as the immunogen

Rabbit monoclonal VEGF antibody (biotin)

The PPIA antibody is a monoclonal antibody that specifically targets the extracellular domain of the protein peptidylprolyl isomerase A (PPIA). PPIA is an enzyme that plays a crucial role in protein folding and is involved in various cellular processes, including interleukin signaling and antiviral defense. The PPIA antibody has been extensively studied and shown to have high affinity binding to PPIA, making it a valuable tool for research in the Life Sciences field.

The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.

The PDIA4 antibody is a powerful tool in the field of Life Sciences. It is designed to target and detect PDIA4, a protein that plays a crucial role in various cellular processes. PDIA4 is involved in oxidative damage repair, actin dynamics, autoantibody production, and the regulation of growth factors such as erythropoietin and epidermal growth factor.

ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA

Mouse monoclonal HMOX2 antibody

SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP

Rabbit polyclonal EXTL3 antibody (biotin)

GBP1 antibody was raised in Rabbit using Human GBP1 as the immunogen

Rabbit polyclonal Casein kinase 2 antibody (HRP)

ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.

The STAT1 antibody is a powerful tool used in Life Sciences research for studying cellular signaling pathways and immune responses. It specifically targets the signal transducer and activator of transcription 1 (STAT1) protein, which plays a crucial role in mediating the effects of interferons and other cytokines.

Rabbit polyclonal COPS5 antibody

Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.

The CEBPB antibody is a highly specific antigen-antibody drug that targets actin, a protein involved in various cellular processes. This monoclonal antibody specifically binds to actin filaments in the nucleus, inhibiting their function and disrupting cellular activities. Additionally, this antibody has been shown to reduce microvessel density, indicating its potential as an anti-angiogenic agent.

Rabbit polyclonal RPS6KB2 antibody

Purified Rabbit polyclonal RACK1A antibody

Rabbit polyclonal SFN antibody

Rabbit polyclonal Dynamin 1 antibody (Ser774)

STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)

Rabbit polyclonal BUD31 antibody

Rabbit polyclonal VPS45 antibody

MLLT4 antibody was raised in Rabbit using Human MLLT4 as the immunogen

RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI

FSCN3 antibody was raised in Rabbit using Human FSCN3 as the immunogen

HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS

MLPH antibody was raised in Rabbit using Human MLPH as the immunogen

DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.

The SH2 antibody is a polyclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets and inhibits the activity of family kinases, making it an effective inhibitor for various cellular processes. Additionally, the SH2 antibody has been shown to have neutralizing effects on proteins such as VEGF (vascular endothelial growth factor) and circumsporozoite protein. It can also be utilized in studies involving mesenchymal stem cells and has shown promising results in inhibiting their growth. The SH2 antibody is a valuable tool for researchers looking to study specific cellular pathways and investigate potential therapeutic targets.

Rabbit polyclonal SMTNL1 antibody

RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG

BOLA1 antibody was raised in Rabbit using Human BOLA1 as the immunogen

Purified Polyclonal BAF170 antibody

Rabbit polyclonal TIA1 antibody

AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Rabbit polyclonal ADA2L antibody

MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen

The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.

The proBNP antibody is a monoclonal antibody that specifically targets and inhibits the activity of proBNP, an important biomarker for heart failure. This antibody has been extensively studied and shown to effectively neutralize proBNP in human serum samples, making it a valuable tool in cardiovascular research and diagnostics. By blocking the binding of proBNP to its receptor, this antibody can help regulate the levels of this peptide hormone, which plays a crucial role in fluid balance and cardiac function. Additionally, the proBNP antibody has potential applications in therapeutic interventions for heart failure and other related conditions. Its specificity and high affinity make it an ideal candidate for further investigation in the field of cardiology and life sciences.

Rabbit polyclonal TCF7 antibody

Rabbit polyclonal AP2S1 antibody (FITC)

Rabbit polyclonal argF antibody (HRP)

Rabbit polyclonal FBXL3 antibody

The HES1 antibody is a potent medicament that belongs to the class of antibodies. It specifically targets and neutralizes the activity of interferon-gamma (IFN-gamma), a growth factor involved in various cellular processes. This monoclonal antibody has been shown to inhibit the expression and function of urokinase plasminogen activator (uPA), which is responsible for thrombocytopenia and other clotting disorders. Additionally, the HES1 antibody has cytotoxic effects on cells expressing alpha-fetoprotein, a marker commonly found in certain types of cancer. Through its binding to the plasminogen activator receptor, this antibody disrupts signal transduction pathways involving tyrosine kinases, leading to impaired cell proliferation and survival. The HES1 antibody is widely used in Life Sciences research for its ability to modulate immune responses and investigate IFN-gamma-related diseases.

The STAT3 antibody is a monoclonal antibody that specifically targets the cytokine family. It has been extensively studied and validated using mass spectroscopy techniques in Life Sciences research. This antibody is designed to detect activated STAT3 in nuclear extracts, making it an essential tool for studying signaling pathways involving this transcription factor. The STAT3 antibody has been used in various applications such as chromatin immunoprecipitation assays to investigate its DNA binding activity and its role in gene regulation. Additionally, this antibody has shown anti-thrombotic properties and has been implicated in oxygen therapy research. Whether you're conducting basic research or exploring therapeutic avenues, the STAT3 antibody is a valuable tool for your studies. Choose from our range of high-quality monoclonal and polyclonal antibodies to meet your specific research needs.

The Fos antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets the nuclear protein Fos, which plays a crucial role in cellular processes such as glucose transporter regulation and growth factor signaling. This antibody is commonly used to study thrombotic microangiopathy, a condition characterized by abnormal clot formation in small blood vessels. By binding to Fos, the antibody allows researchers to visualize and analyze the activation of this important protein. In addition to its use in research, there are also polyclonal antibodies available for detecting other components of the actin filaments, such as phalloidin or actin itself. These antibodies are valuable tools for studying atypical hemolytic disorders and other conditions involving actin dynamics. With their high specificity and sensitivity, these antibodies provide researchers with reliable results for their experiments.

LMBR1L antibody was raised in Rabbit using Human LMBR1L as the immunogen

Rabbit polyclonal FUCA2 antibody

Mouse thrombocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymocytes as the immunogen.

LDHAL6A antibody was raised in Rabbit using Human LDHAL6A as the immunogen

MLF2 antibody was raised in Rabbit using Human MLF2 as the immunogen

Calpain 2 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-calpain as the immunogen.

NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF

Rabbit polyclonal ARPC3 antibody (biotin)

Rat monoclonal CD9 antibody (FITC)

Purified Polyclonal EAAT3 antibody

BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL