Anticorps primaires

Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.

HSDL1 antibody was raised in Rabbit using Human HSDL1 as the immunogen

Affinity purified Rabbit polyclonal Collagen I alpha 2 antibody

Affinity purified Rabbit polyclonal DJA1 antibody

The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). This receptor plays a crucial role in various biological processes, including inflammation, cell proliferation, and cell survival. The RAGE antibody has cytotoxic properties and can neutralize the effects of RAGE activation.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infection due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The efficacy of this drug has been demonstrated through patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

AChE antibody was raised in mouse using purified human cerebellar acetylcholinesterase as the immunogen.

Goat anti-human IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

alpha 2 Antiplasmin antibody was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.

Rabbit polyclonal SECP43 antibody

Affinity purified Rabbit polyclonal GLYATL1 antibody

POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen

RHOU antibody was raised using the C terminal of RHOU corresponding to a region with amino acids LKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by inhibiting DNA-dependent RNA polymerase, which hinders transcription and replication processes essential for bacterial survival. The effectiveness of this drug has been confirmed through extensive testing using advanced techniques such as patch-clamp on human erythrocytes. Additionally, its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively impedes their growth in culture.

The Caspase 2 antibody is a cytotoxic monoclonal antibody that targets the Caspase 2 protein. This antibody has been shown to have significant growth factor inhibitory effects and can be used in various research applications. It specifically binds to the Caspase 2 protein, which plays a critical role in apoptosis, or programmed cell death. The antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting experiments to study the expression and localization of Caspase 2 in different tissues and cell types. Additionally, it has been successfully used in combination with other antibodies, such as anti-CD33 antibodies or trastuzumab, to enhance their cytotoxic effects. This highly specific antibody recognizes both native and denatured forms of the Caspase 2 protein and is suitable for use with human serum samples. Its high affinity for Caspase 2 ensures accurate detection and reliable results in Life Sciences research.

Rabbit polyclonal MTR1A antibody

The Ibuprofen antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of Ibuprofen, a nonsteroidal anti-inflammatory drug (NSAID). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The antibody specifically binds to Ibuprofen, leading to its neutralization and preventing it from exerting its anti-inflammatory effects.

Affinity purified Rabbit polyclonal Calpain 5 antibody

The HSF1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes arginase, an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in blocking the activity of arginase, allowing researchers to investigate its role in different biological systems.

Chicken polyclonal MTBE antibody

The SAMHD1 antibody is a highly specialized tool used in various assays and research applications. It specifically targets SAMHD1, an EGF-like glycoprotein involved in cellular processes. This antibody is designed to inhibit the activity of SAMHD1 and can be used as a valuable tool for studying its function.

Rabbit polyclonal RAB39B antibody

Rabbit polyclonal Ferritin heavy chain antibody (FITC)

The TRIM23 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets chemokines and autoantibodies, making it an essential component in various experiments and assays. It has been extensively tested and proven to effectively neutralize interferon-gamma (IFN-gamma) and growth factors, allowing for accurate measurements and analysis. Additionally, the TRIM23 antibody has demonstrated high affinity towards human folate, actin filaments, taxol, and alpha-fetoprotein, making it a versatile option for a wide range of applications. With its exceptional specificity and reliability, this polyclonal antibody is an invaluable asset for any laboratory or research facility. Trust the TRIM23 antibody to deliver consistent results and advance your scientific endeavors.

SLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT

MLLT3 antibody was raised in Rabbit using Human MLLT3 as the immunogen

Affinity purified Rabbit polyclonal CDC37L1 antibody

HBS1L antibody was raised in Rabbit using Human HBS1L as the immunogen

The ITGB3 antibody is a highly specialized product that is used in the field of Life Sciences. This antibody specifically targets and binds to the integrin beta-3 subunit (ITGB3), which plays a critical role in various cellular processes. The ITGB3 antibody has been extensively studied for its potential therapeutic applications.

The Homer antibody is a growth factor that is commonly found in human serum. It is widely used in Life Sciences research and has been shown to have neutralizing effects on various nuclear factors. The antibody can be used for both in vitro and in vivo experiments, making it a versatile tool for researchers. It is available as both monoclonal and polyclonal antibodies, allowing for flexibility in experimental design. The Homer antibody has been extensively studied for its role in inhibiting the activity of mesothelin, a protein involved in cancer progression. Additionally, it has shown potential as an inhibitor of fibrinogen, collagen, and alpha-fetoprotein. Its antiviral properties make it a valuable asset in the field of virology research. With its wide range of applications and proven efficacy, the Homer antibody is a must-have for any researcher looking to advance their scientific understanding.

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

HCII antibody was raised in goat using human HCII purified from plasma as the immunogen.

The HTR1A antibody is a highly valuable product in the field of Life Sciences. It plays a crucial role as a heparin cofactor and is used in various medical applications, including as an inhibitor for certain medications. Additionally, this antibody has been found to have significant effects on fetal hemoglobin and autoantibodies.

Mouse monoclonal CDK5 antibody (N-terminus)

GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen

Affinity purified Rabbit polyclonal EXOC7 antibody

The TIMP3 antibody is a monoclonal antibody that targets the tissue inhibitor of metalloproteinase 3 (TIMP3). TIMP3 plays a crucial role in regulating endothelial growth and inhibiting the activity of metalloproteinases, which are enzymes involved in tissue remodeling. This antibody specifically binds to TIMP3 and can be used for various research purposes in the field of life sciences.

Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.

Affinity purified Rabbit polyclonal BclB antibody

SPSB2 antibody was raised in rabbit using the N terminal of SPSB2 as the immunogen

MYC antibody was raised in Rabbit using Human MYC as the immunogen

The MST4 antibody is a polyclonal antibody that specifically targets and binds to the triglyceride lipase known as MST4. This antibody is widely used in life sciences research to study the role of MST4 in various biological processes. It has been shown to be effective in detecting and quantifying MST4 levels in adipose tissue, as well as its involvement in signaling pathways regulated by TGF-β1. The MST4 antibody can also be used for immunohistochemistry, Western blotting, and other techniques to analyze the expression and localization of MST4 in different cell types and tissues. With its high specificity and sensitivity, this antibody is an invaluable tool for researchers studying lipase function and related diseases such as obesity and metabolic disorders.

CCPG1 antibody was raised in Rabbit using Human CCPG1 as the immunogen

Purified Rabbit polyclonal MADS85 antibody

ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

Affinity purified Rabbit polyclonal SUCLG1 antibody

The CtIP antibody is a powerful diagnostic agent that is used in Life Sciences research. It acts as a parp inhibitor, which means it inhibits the activity of poly(ADP-ribose) polymerase (PARP), an enzyme involved in DNA repair. This antibody is luminescent and can be detected using particle chemiluminescence or other detection methods. It specifically targets CtIP, a protein involved in DNA recombination and repair, making it an essential tool for studying these processes. The CtIP antibody can be conjugated to streptavidin or magnetic particles for easy detection and purification. Whether you are conducting research or developing new therapies, this antibody is a valuable tool for understanding and manipulating cellular processes.

Affinity purified Rabbit polyclonal Nucleoporin p62 antibody

Desmoglein 3 antibody is a polyclonal antibody that specifically targets the desmoglein 3 protein. Desmoglein 3 is a component of desmosomes, which are intercellular junctions involved in cell adhesion. This antibody can be used in various research applications, including immunohistochemistry and western blotting, to study the expression and function of desmoglein 3 in different tissues and cell types.

ALKBH4 antibody was raised in Rabbit using Human ALKBH4 as the immunogen

HOXC4 antibody was raised in Rabbit using Human HOXC4 as the immunogen

Rabbit polyclonal PNRC2 antibody

Mouse monoclonal MTFMT antibody

FCAMR antibody was raised in rabbit using the C terminal of FCAMR as the immunogen

ENO3 antibody was raised in Rabbit using Human ENO3 as the immunogen

Affinity purified Rabbit polyclonal PDSS2 antibody

The SNAP25 antibody is a polyclonal antibody that specifically targets the protein kinase SNAP25. It is commonly used in life sciences research to study the function and regulation of this important protein. This antibody has been extensively tested and validated for various applications, including immunofluorescence, immunohistochemistry, and western blotting.

CPNE6 antibody was raised in Rabbit using Human CPNE6 as the immunogen

Rabbit polyclonal RASGEF1A antibody

BATF antibody was raised in Rabbit using Human BATF as the immunogen

Rabbit polyclonal EPHB2 antibody (Tyr298)

Factor IX antibody is a highly specialized polyclonal antibody that targets and neutralizes the activity of Factor IX, a crucial protein involved in blood clotting. This antibody is widely used in Life Sciences research and diagnostic applications. It has been extensively studied for its potential therapeutic use as an anti-her2 antibody, monoclonal antibody, and family kinase inhibitor. Factor IX antibody has also been shown to have an inhibitory effect on interferon, chemokine, and epidermal growth factor signaling pathways. Its high specificity and affinity make it an ideal tool for various immunoassays, including enzyme-linked immunosorbent assays (ELISA) and Western blotting. Additionally, this antibody can be conjugated with different molecules or labeled with spectrometric tags for advanced detection methods. With its lysine-specific binding properties, Factor IX antibody offers researchers a valuable resource for studying blood coagulation disorders and developing targeted therapies.

ALDH3B1 antibody was raised using the N terminal of ALDH3B1 corresponding to a region with amino acids DPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQD

The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.

Cytokeratin 20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.

PCNP antibody was raised using the middle region of PCNP corresponding to a region with amino acids AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

ETV1 antibody was raised in rabbit using the N terminal of ETV1 as the immunogen

CAPN7 antibody was raised in Rabbit using Human CAPN7 as the immunogen

Purified Rabbit polyclonal USP35 antibody

The IL8 antibody is a highly specific antibody used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody targets IL8, which is an important chemokine involved in inflammation and immune responses. The IL8 antibody can be used for various applications, including immunohistochemistry, flow cytometry, and ELISA. It has been extensively validated and shows high sensitivity and specificity in detecting IL8 in various samples. The IL8 antibody is produced using advanced techniques to ensure high purity and activity. It is supplied as a buffered solution for easy handling and storage. Whether you are studying autoimmune diseases or investigating the role of IL8 in cancer development, the IL8 antibody is a valuable tool for your research needs.

Rabbit polyclonal PYGB antibody

SPTAN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ

Mouse monoclonal NUDT18 antibody

The Sumo1 antibody is a polyclonal antibody that is used for the immobilization of human serum on an electrode. It is commonly used in research and laboratory settings to study the binding proteins and inhibitors involved in various cellular processes. This antibody has also been shown to have neutralizing effects on interferon, making it a valuable tool in immunology research. Additionally, the Sumo1 antibody has demonstrated neuroprotective properties and has been investigated for its potential use in treating neurodegenerative disorders. However, it is important to note that this antibody may have teratogenic effects and should be handled with caution. In the field of Life Sciences, the Sumo1 antibody plays a crucial role in understanding cellular pathways and protein interactions.

The CYP2A6 antibody is a highly specialized monoclonal antibody that is widely used in clinical research and diagnostics. It is specifically designed to detect the presence of CYP2A6, an important protein kinase involved in various cellular processes. This antibody has proven to be highly effective in immunohistochemistry studies, allowing for the precise localization and quantification of CYP2A6 expression in tissues and cells. Its high specificity ensures accurate detection, making it an invaluable tool for researchers working in the field of oncology, as well as other areas of life sciences. With its exceptional performance and reliability, the CYP2A6 antibody is a must-have for any laboratory or research facility conducting studies related to protein expression and function.

Affinity purified Rabbit polyclonal NCKAP1 antibody

Affinity purified Rabbit polyclonal LARS2 antibody

EI24 antibody was raised in Rabbit using Human EI24 as the immunogen

Rabbit polyclonal RNF168 antibody

NFE2 antibody was raised in Rabbit using Human NFE2 as the immunogen

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN

Purified Polyclonal ABCC13 antibody

Affinity purified Rabbit polyclonal GULP1 antibody

Affinity purified Rabbit polyclonal LETM1 antibody

The PDIA4 antibody is a highly specialized product in the field of Life Sciences. It possesses unique characteristics that make it a valuable tool for various applications. This monoclonal antibody has been developed to target and neutralize the activity of PDIA4, a protein kinase involved in important cellular processes.

Rabbit polyclonal RTN1 antibody

Affinity purified Rabbit polyclonal UBE2B antibody

FSCN3 antibody was raised in Rabbit using Human FSCN3 as the immunogen

Affinity purified Rabbit polyclonal GCM2 antibody

The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.

EBAG9 antibody was raised in Rabbit using Human EBAG9 as the immunogen

The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.