Anticorps primaires

MTGR1 antibody was raised in Rat using MTGR1 peptide couple to carrier protein as the immunogen.

DLG3 antibody was raised in Rabbit using Human DLG3 as the immunogen

FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV

The SUV39H1 antibody is a high-quality polyclonal antibody that specifically targets the SUV39H1 protein. This protein is a histone methyltransferase that plays a crucial role in gene regulation and chromatin organization. The SUV39H1 antibody is designed to detect and bind to the activated form of SUV39H1, making it an essential tool for researchers studying epigenetics and gene expression.

P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRIHRAEKLPGERDG

ELP4 antibody was raised in Rabbit using Human ELP4 as the immunogen

Rabbit polyclonal NUP54 antibody

WDSUB1 antibody was raised using the middle region of WDSUB1 corresponding to a region with amino acids KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS

ANAPC1 antibody was raised in Rabbit using Human ANAPC1 as the immunogen

LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW

Affinity purified Rabbit polyclonal SESN3 antibody

The Rho antibody is a monoclonal antibody that targets sclerostin, a protein that acts as an inhibitor of bone formation. By binding to sclerostin, this antibody enhances osteoblast activity and promotes bone growth. It has also been shown to inhibit phosphatase activity, which further supports bone formation. Additionally, the Rho antibody has been found to have cytotoxic effects on certain cancer cells and can interfere with endothelial growth factor signaling. This antibody is widely used in Life Sciences research for studying bone development and growth factors. It is available as both a monoclonal and polyclonal antibody, offering researchers different options for their specific needs. Whether you are studying bone biology or investigating potential therapeutic targets, the Rho antibody is a valuable tool in your research arsenal.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

Affinity purified Rabbit polyclonal RGS13 antibody

GPC1 antibody was raised in Rabbit using Human GPC1 as the immunogen

Purified Rabbit polyclonal CBLN1 antibody

GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL

Rabbit polyclonal TENS3 antibody

The PSA antibody is a monoclonal antibody that specifically targets the prostate-specific antigen (PSA) found in human serum. It is designed to bind to PSA and inhibit its activity. This antibody is produced using histidine-tagged recombinant proteins and has been shown to effectively detect PSA levels in various diagnostic tests, such as enzyme-linked immunosorbent assays (ELISA) or immunohistochemistry.

The KRT19 antibody is a highly effective neutralizing agent used in Life Sciences. It is designed to target specific epitopes and bind to the desired antigens with high affinity. This antibody is produced using state-of-the-art technology and undergoes rigorous quality control measures to ensure its effectiveness.

COX5A antibody was raised in Rabbit using Human COX5A as the immunogen

Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ

CD16 antibody (biotin) was raised in rat using murine CD16/32 (CD16/Fc gamma II and CD32/Fc gamma III receptors)

The SIVA1 antibody is a highly specific monoclonal antibody that targets the biomolecule SIVA1. It is derived from isolated nucleic acids and collagen, making it a powerful tool for research in the field of Life Sciences. The SIVA1 antibody has been developed using cell hybridomas and chromatographic techniques to ensure high purity and specificity. It binds to hyaluronan receptors on the cell-extracellular matrix interface, allowing for precise detection and analysis of SIVA1 in various biological samples. This specific antibody can be used in applications such as immunohistochemistry, Western blotting, and ELISA assays to study the function and expression of SIVA1 in different cellular contexts. With its exceptional sensitivity and selectivity, the SIVA1 antibody is an invaluable asset for scientists seeking to unravel the complexities of cellular signaling pathways and protein interactions.

Sheep polyclonal 17b Estradiol 6 antibody

The DNM1 antibody is a highly effective medicament that has shown promising results in inhibiting the growth of carcinoma cell lines. This monoclonal antibody specifically targets a growth factor that is essential for the proliferation of cancer cells, making it a potential breakthrough in cancer treatment. The DNM1 antibody has been extensively studied in Life Sciences and has been proven to be a potent inhibitor of tumor growth. Additionally, this antibody can be used as a selectable marker in research experiments due to its high specificity and sensitivity. With its ability to target specific markers expressed by cancer cells, the DNM1 antibody holds great potential for personalized medicine and targeted therapy approaches.

Mouse monoclonal CD49d antibody (FITC)

Cytokeratin 8 antibody is a neutralizing monoclonal antibody that targets collagen. It is used in Life Sciences research to study the role of cytokeratin 8 in various cellular processes. This antibody can specifically bind to cytokeratin 8, which is an intermediate filament protein found in epithelial cells. By targeting cytokeratin 8, this antibody can help researchers investigate its interactions with other proteins such as e-cadherin and β-catenin, as well as its involvement in signaling pathways mediated by growth factors like epidermal growth factor and TGF-beta. Additionally, the use of this antibody has been shown to correlate with changes in microvessel density and activation of certain cellular processes. With its high specificity and affinity for cytokeratin 8, this antibody is a valuable tool for studying the biology of epithelial cells and their associated diseases.

Rabbit polyclonal PPIL5 antibody

Rabbit Polyclonal OR2A7 antibody

Affinity purified Rabbit polyclonal Cullin 7 antibody

Affinity purified Rabbit polyclonal Dyrk3 antibody

CREM antibody was raised in Rabbit using Human CREM as the immunogen

Affinity purified Rabbit polyclonal IDI1 antibody

Rabbit polyclonal CUTL1 antibody

The SLN antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and detect arginase, an enzyme involved in the metabolism of arginine. This antibody recognizes specific glycan structures on the arginase protein, allowing for accurate detection and quantification.

Goat anti-human IgG (Rhodamine) was raised in goat using human IgG heavy chain as the immunogen.

The P38 MAPK antibody is a highly specialized tool used in Life Sciences research. It is an electrode-based antibody that specifically targets and binds to the p38 mitogen-activated protein kinase (MAPK) antigen. This antibody is widely used in various research assays to study the role of p38 MAPK in cellular processes such as glucose-6-phosphate metabolism, inflammation, and cell signaling.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.

Rabbit polyclonal NK2R antibody

The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.

MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen

Affinity purified Rabbit polyclonal HLADR beta antibody

Rabbit polyclonal RPAIN antibody

SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen

LYZL1 antibody was raised in Rabbit using Human LYZL1 as the immunogen

Rabbit polyclonal RNASE13 antibody

Rabbit polyclonal CARD6 antibody

Affinity purified Rabbit polyclonal MSTO1 antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.