Anticorps primaires

Rabbit polyclonal TAF7 antibody

Rabbit polyclonal MPRG antibody

The NUFIP1 antibody is a powerful medicament that acts as an interferon and carboxyl esterase inhibitor. It has antiviral properties and is commonly used in the development of vaccines. This antibody works by inhibiting the formation of antibodies, making it an effective tool for studying immune responses. Additionally, it can be used as a fluorescence probe in various life sciences applications. With its ability to bind to specific targets, the NUFIP1 antibody is a valuable tool for researchers and scientists working in the field of medicine and immunology.

Goat anti-rat IgG (Fab'2) (FITC) was raised in goat using rat IgG F(c) fragment as the immunogen.

CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen

The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.

Mouse monoclonal SNX8 antibody

MAD2L1 antibody was raised in rabbit using the middle region of MAD2L1 as the immunogen

The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.

Affinity purified Rabbit polyclonal FLJ32786 antibody

Goat anti-mouse IgM (Fab'2) was raised in goat using murine IgM mu heavy chain as the immunogen.

The VPAC2 antibody is a glycoprotein that acts as an endonuclease. It specifically targets and binds to the VPAC2 receptor, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody is commonly used in life sciences research and has applications in fields such as immunology, cancer research, and drug development.

G6pc antibody was raised in rabbit using the N terminal of G6pc as the immunogen

WNT10B antibody was raised in Mouse using a purified recombinant fragment of human WNT10B expressed in E. coli as the immunogen.

Affinity purified Mouse polyclonal DAPK2 antibody

Rabbit polyclonal GPR123 antibody

Rabbit polyclonal GPR176 antibody

AGTRAP antibody was raised in Rabbit using Human AGTRAP as the immunogen

DDIT4L antibody was raised using the middle region of DDIT4L corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL

Affinity purified Rabbit polyclonal SCIN antibody

FBXL14 antibody was raised in Rabbit using Human FBXL14 as the immunogen

ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.

Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

The STOML1 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor. It specifically binds to the histidine residues on the receptor, blocking its activation and inhibiting downstream signaling pathways. This antibody has been extensively studied in Life Sciences research and has shown promising results in various applications.

Affinity purified Rabbit polyclonal LOC169436 antibody

MDC antibody was raised in rabbit using highly pure recombinant murine MDC as the immunogen.

CD3e antibody (Spectral Red) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.

FKBP7 antibody was raised in Rabbit using Human FKBP7 as the immunogen

BRUNOL6 antibody was raised in Rabbit using Human BRUNOL6 as the immunogen

Rabbit polyclonal CSTF1 antibody

Affinity purified Rabbit polyclonal Ran BP1 antibody

The Cytokeratin 19 antibody is a highly effective polyclonal antibody that targets and binds to Cytokeratin 19, a protein that plays a crucial role in cell adhesion and differentiation. This antibody has been extensively tested and proven to be reliable in detecting the presence of Cytokeratin 19 in various biological samples.

Insulin antibody is a specialized antibody that is used for the detection and measurement of insulin levels in various biological samples. It can be used in research, diagnostic, and clinical settings to study conditions such as hyperinsulinaemic hypoglycaemia or insulin resistance. This antibody is produced by antibody-secreting cells and can be obtained in both polyclonal and monoclonal forms. The polyclonal antibodies are derived from animals immunized with recombinant human insulin, while the monoclonal antibodies are generated through hybridoma technology. Insulin antibodies specifically bind to insulin molecules present in the sample, allowing for their detection and quantification. This enables researchers and healthcare professionals to accurately measure insulin levels in human serum or other biological fluids. The use of insulin antibodies offers a reliable and sensitive method for insulin detection. These antibodies have been extensively validated for their specificity and sensitivity, ensuring accurate results. They recognize specific epitopes on the insulin molecule, such as certain amino acid residues or the

NQO1 antibody was raised in rabbit using the C terminal of NQO1 as the immunogen

Rabbit polyclonal USP36 antibody

Rabbit polyclonal RPS14 antibody (biotin)

The ITGB3 antibody is a highly specialized polyclonal antibody that acts as a family kinase inhibitor. It is designed to target and neutralize specific factors in the body, making it an effective antiviral and factor antagonist. This antibody also serves as a cdk4/6 inhibitor, inhibiting the activity of cyclin-dependent kinases 4 and 6.

The HSF1 antibody is a medicament that consists of dimers with an amino-terminal domain. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α) and natriuretic peptides. This glycoprotein antibody is widely used in Life Sciences research for its ability to detect and quantify specific proteins in various biological samples. The HSF1 antibody can be used in applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The HSF1 antibody's high specificity and sensitivity make it an essential tool for studying cellular processes and protein functions. With its advanced glycosylation techniques, this antibody ensures accurate results by minimizing non-specific binding and interference from other molecules.

U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

Rabbit polyclonal CEB alpha antibody (Ser21)

KCTD14 antibody was raised in Rabbit using Human KCTD14 as the immunogen

The SLC22A17 antibody is a powerful tool used in Life Sciences research for the detection and analysis of cxcl13, a nuclear antigen. This polyclonal antibody has been extensively tested and validated for various applications, including immunohistochemistry and DNA-binding protein studies. It specifically recognizes and binds to the surface glycoprotein expressed by SLC22A17, forming a specific complex that can be visualized using techniques such as impedance spectroscopy. With its high specificity and sensitivity, this monoclonal antibody is an essential component in any research project requiring the detection of SLC22A17. Trust in its reliability and accuracy to advance your scientific endeavors.

ICAM2 antibody is a growth factor that plays a crucial role in various cellular processes. It has been shown to be involved in the regulation of immune responses, cell adhesion, and signal transduction. This antibody specifically targets ICAM2, an antigen expressed on the surface of cells.

CTSL2 antibody was raised in rabbit using the C terminal of CTSL2 as the immunogen

MRPS27 antibody was raised in Rabbit using Human MRPS27 as the immunogen

Affinity purified Rabbit polyclonal KLRC4 antibody

Affinity purified Rabbit polyclonal Integrin alpha 2b antibody

RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Affinity purified Rabbit polyclonal BRE antibody

CD19 antibody was raised in Mouse using a purified recombinant fragment of human CD19 expressed in E. coli as the immunogen.

Rabbit polyclonal GRIN2C antibody (Ser1096)

IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen

Rabbit polyclonal PECR antibody

The VAPA antibody is a neutralizing anti-CD33 antibody that is widely used in the field of Life Sciences. It is commonly employed in immunohistochemistry studies to detect and analyze the expression of CD33, a cell surface protein involved in various cellular processes. This antibody specifically targets and binds to CD33, blocking its activity and preventing its interaction with other molecules.

RNF212 antibody was raised using the middle region of RNF212 corresponding to a region with amino acids LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.