Anticorps primaires

Mouse monoclonal HVEM antibody (PE)

Rabbit polyclonal STK33 antibody

QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI

The RHEB antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is used to detect and target RHEB, a protein involved in various cellular processes. This antibody has been extensively studied for its ability to inhibit the activity of RHEB, making it a valuable tool for research and therapeutic applications.

ANGPTL3 antibody was raised in rabbit using the N terminal of ANGPTL3 as the immunogen

AAAS antibody was raised in Rabbit using Human AAAS as the immunogen

SAR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The SERCA2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the nuclear protein SERCA2, which is involved in the regulation of calcium ion transport. This antibody is commonly used to study the role of SERCA2 in various biological processes such as glucose-6-phosphate metabolism and tyrosine phosphorylation. Additionally, it has been utilized in the detection and quantification of autoantibodies, including antiphospholipid antibodies, which are associated with autoimmune disorders. The SERCA2 antibody can also be used as an anti-connexin agent to block gap junction communication and investigate its impact on cellular signaling pathways. Furthermore, this antibody has potential applications as an anticoagulant due to its ability to inhibit collagen-induced platelet aggregation. With its high specificity and versatility, the SERCA2 antibody is a valuable tool for researchers in multiple fields of study.

The CCR6 antibody is a powerful tool in the field of life sciences. It is an antibody that specifically targets and binds to the CCR6 protein, which plays a crucial role in various biological processes. The CCR6 antibody can be used for research purposes such as studying the activation of growth factors and tyrosine kinase receptors. It has also been shown to have cytotoxic effects, making it a potential candidate for antibody-drug conjugates.

Rabbit polyclonal GRIN2A antibody

Affinity purified Rabbit polyclonal IP6K1 antibody

FBP1 antibody was raised in Rabbit using Human FBP1 as the immunogen

Affinity purified Rabbit polyclonal Cullin 3 antibody

PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS

FAF1 antibody was raised in Rabbit using Human FAF1 as the immunogen

LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ

The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in Life Sciences research for various applications. This neutralizing antibody can effectively block the interaction between EpCAM and its ligands, preventing downstream signaling events.

ITGA3 antibody was raised in Rabbit using Human ITGA3 as the immunogen

Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.

Rabbit polyclonal Aquaporin 2 antibody (Ser256)

Affinity purified Rabbit polyclonal SPFH2 antibody

TCHP antibody was raised in rabbit using the C terminal of TCHP as the immunogen

Affinity purified Rabbit polyclonal GPR137B antibody

Goat anti-cat IgG was raised in goat using feline IgG F(ab')2 fragment as the immunogen.

CD44 antibody (Allophycocyanin) was raised in rat using murine CD44 as the immunogen.

ZNF326 antibody was raised in rabbit using the C terminal of ZNF326 as the immunogen

The BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to BP1, a protein that is found in human serum. The binding of the BP1 antibody to its target protein can be used for various applications, including research and diagnostic purposes.

SLC7A11 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

NFE2L1 antibody was raised in Rabbit using Human NFE2L1 as the immunogen

RRP1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

SITPEC antibody was raised in rabbit using the middle region of SITPEC as the immunogen

The TP53 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes epidermal growth factor (EGF)-like growth factor, which plays a crucial role in cell proliferation and survival. This antibody is designed to bind with high affinity to EGF-like growth factors, preventing their interaction with receptors on the surface of cells.

GRIN1 antibody was raised in Rabbit using Human GRIN1 as the immunogen

Rabbit polyclonal ALPI antibody

The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.

Mouse monoclonal ACOT12 antibody

GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Rabbit polyclonal TRIP4 antibody

COL8A2 antibody was raised in rabbit using the C terminal of COL8A2 as the immunogen

Affinity purified Rabbit polyclonal DPYD antibody

Rabbit polyclonal VOPP1 antibody (FITC)

CD19 antibody (Allophycocyanin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.

Rabbit polyclonal Zap 70 antibody

Rabbit polyclonal RNASEH1 antibody

ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

CBX1 antibody was raised in Rabbit using Human CBX1 as the immunogen

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.