Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
IFNAR2 antibody
IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.
SPTLC1 antibody
The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.
MYL3 antibody
MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.
Cathepsin D antibody
The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.
NOTCH3 antibody
The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
SSTR2 antibody
The SSTR2 antibody is a highly specialized monoclonal antibody that targets the somatostatin receptor 2 (SSTR2). This antibody has been extensively studied and characterized for its ability to specifically bind to SSTR2, making it an invaluable tool in various research applications.
ATXN1 antibody
The ATXN1 antibody is a highly reactive and neutralizing polyclonal antibody that specifically targets the ATXN1 protein. This protein is involved in various cellular processes, including cell signaling and gene expression regulation. The ATXN1 antibody has been shown to be effective in blocking the activity of ATXN1, making it an ideal tool for studying its function and potential therapeutic applications. It can also be used as a diagnostic tool to detect the presence of autoantibodies against ATXN1 in human serum. The ATXN1 antibody is produced using advanced techniques and quality control measures to ensure its purity and specificity. With its high affinity and selectivity, this monoclonal antibody provides reliable results in various research settings.
STK24 antibody
The STK24 antibody is a polyclonal antibody that is highly effective in targeting and neutralizing cytotoxic factors in various biological samples, including pleural fluid, human serum, and tissue culture media. This antibody specifically binds to STK24, a protein kinase involved in the regulation of cell growth and survival. By binding to STK24, this antibody inhibits its activity and prevents the downstream signaling pathways that promote cell proliferation and survival.
Angiotensinogen antibody
The Angiotensinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize angiotensinogen, a protein that plays a key role in the regulation of blood pressure and fluid balance in the body. This antibody has been extensively studied and proven to be effective in blocking the activation of angiotensinogen, thereby preventing its interaction with other molecules such as atrial natriuretic peptide and albumin.
NOX1 antibody
The NOX1 antibody is a highly specialized polyclonal antibody that targets the oncostatin receptor. It is designed to specifically bind to glial fibrillary acidic protein (GFAP), an antigen expressed in glial cells. This antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence and localization of GFAP in tissues or cell cultures.
TM9SF1 antibody
TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG
AVEN antibody
The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.
MFAP3L antibody
MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
Factor VIII antibody
Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.
KCNH6 antibody
KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
GILT antibody
The GILT antibody is a cytotoxic monoclonal antibody that specifically targets amyloid plaque protein dimers. It is widely used in Life Sciences research to study the formation and accumulation of amyloid plaques, which are associated with various neurodegenerative diseases such as Alzheimer's disease. This monoclonal antibody has high specificity and affinity for amyloid plaque protein dimers, making it an excellent tool for detecting and quantifying these abnormal protein aggregates. Additionally, the GILT antibody has been shown to have inhibitory effects on the growth factor signaling pathway, making it a potential therapeutic candidate for diseases characterized by excessive cell proliferation. With its exceptional quality and reliability, this antibody is a valuable asset for researchers investigating amyloid-related disorders.
NEDD9 antibody
NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
TNFSF13 antibody
TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen
Donkey anti Guinea Pig IgG (H + L) (HRP)
Donkey anti-guinea pig IgG (H + L) (HRP) was raised in donkey using guinea pig IgG (H & L) as the immunogen.
SCNN1A antibody
The SCNN1A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the enteroendocrine cells and interferon production. This antibody has been extensively studied for its glycosylation patterns and its ability to induce caspase-9 activation, leading to cell lysis. Additionally, it has shown neutralizing effects on cytotoxic growth factors and anti-DNP antibodies. The viscosity of this antibody solution is optimized for easy handling and storage. Whether you're conducting experiments or performing assays, the SCNN1A antibody is a valuable tool in your research arsenal.
alpha Synuclein antibody
The alpha Synuclein antibody is a powerful tool in the field of Life Sciences. It specifically targets alpha-synuclein, a protein that plays a crucial role in neurodegenerative disorders such as Parkinson's disease. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.
Transglutaminase 5 antibody
Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
TIE2 antibody
The TIE2 antibody is a monoclonal antibody that targets the growth factor receptor TIE2. This receptor plays a crucial role in regulating angiogenesis and vascular endothelial cell function. By binding to TIE2, the antibody blocks the activation of downstream signaling pathways, inhibiting tumor growth and metastasis.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
