Anticorps primaires

The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.

Affinity purified Rabbit polyclonal CaMKII delta antibody

ALDOA antibody was raised in Rabbit using Human ALDOA as the immunogen

Affinity purified Rabbit polyclonal dUTPase antibody

The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.

Rabbit polyclonal OR2AK2 antibody

Affinity purified Rabbit polyclonal ALPL antibody

The CSE1L antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor (EGF) receptor. It is widely used in life sciences research to study the role of EGF and its signaling pathways. This antibody specifically binds to the activated form of the EGF receptor, inhibiting its function and preventing downstream signaling events. The CSE1L antibody has been shown to be effective in blocking the growth and proliferation of cancer cells that overexpress the EGF receptor, making it a promising therapeutic candidate for cancer treatment. Additionally, this antibody can be used as a tool in various experimental techniques, such as immunohistochemistry and Western blotting, to detect and quantify EGF receptor expression levels in different cell types and tissues. With its high specificity and sensitivity, the CSE1L antibody is an invaluable resource for researchers studying EGF-related signaling pathways and their implications in various biological processes.

Purified Polyclonal PPP4R1L antibody

Purified Polyclonal NAA15 antibody

Rabbit polyclonal UQCRQ antibody

Rabbit polyclonal CaMK2 alpha/beta/theta antibody

Affinity purified Rabbit polyclonal PMM2 antibody

Insulin antibody is a specialized antibody that is used for the detection and measurement of insulin levels in various biological samples. It can be used in research, diagnostic, and clinical settings to study conditions such as hyperinsulinaemic hypoglycaemia or insulin resistance. This antibody is produced by antibody-secreting cells and can be obtained in both polyclonal and monoclonal forms. The polyclonal antibodies are derived from animals immunized with recombinant human insulin, while the monoclonal antibodies are generated through hybridoma technology. Insulin antibodies specifically bind to insulin molecules present in the sample, allowing for their detection and quantification. This enables researchers and healthcare professionals to accurately measure insulin levels in human serum or other biological fluids. The use of insulin antibodies offers a reliable and sensitive method for insulin detection. These antibodies have been extensively validated for their specificity and sensitivity, ensuring accurate results. They recognize specific epitopes on the insulin molecule, such as certain amino acid residues or the

FBXL14 antibody was raised in Rabbit using Human FBXL14 as the immunogen

MYO7B antibody was raised in Rabbit using Human MYO7B as the immunogen

IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE

The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.

GCLM antibody was raised in Rabbit using Human GCLM as the immunogen

The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.

RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA

Affinity purified Rabbit polyclonal Neuregulin 2 antibody

Affinity purified Mouse polyclonal XRCC1 antibody

CD3E antibody was raised in Rabbit using Human CD3E as the immunogen

Collagen type II antibody was raised in mouse using purified preparation of lathritic type II collagen from embryonic chicken sternum as the immunogen.

HTR7 antibody was raised in rabbit using the N terminal of HTR7 as the immunogen

Rabbit polyclonal PPIL1 antibody

Affinity purified Rabbit polyclonal HS1BP3 antibody

Thrombospondin antibody is a powerful tool used in Life Sciences research to study various biological processes. It specifically targets and detects the presence of thrombospondin, a protein involved in cell growth, angiogenesis, and wound healing. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). By binding to thrombospondin, this antibody allows researchers to investigate its role in different cellular pathways and understand its interactions with other molecules like epidermal growth factor (EGF), alpha-fetoprotein, serotonin, and c-myc. With its high specificity and sensitivity, the thrombospondin antibody provides valuable insights into the molecular mechanisms underlying these processes.

Affinity purified Rabbit polyclonal ENTPD6 antibody

Rabbit polyclonal RPS14 antibody (biotin)

RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Affinity purified Rabbit polyclonal Integrin alpha 2b antibody

Affinity purified Rabbit polyclonal KLRC4 antibody

CTSL2 antibody was raised in rabbit using the C terminal of CTSL2 as the immunogen

U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

DCX antibody was raised in Rabbit using Human DCX as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro

The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.

Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

ACTR10 antibody was raised in Rabbit using Human ACTR10 as the immunogen

RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

The ADAMTS4 antibody is a highly specialized protein that has cytotoxic properties and promotes the growth of keratinocytes and endothelial cells. It is commonly used in research and medical applications to study the function of ADAMTS4, a protein involved in various cellular processes. This antibody specifically targets the circumsporozoite protein, which is expressed on the surface of certain cells. Additionally, it has been shown to have neutralizing effects on other proteins such as anti-CD33 antibody, growth factors, and family kinase inhibitors. The ADAMTS4 antibody is a valuable tool for scientists and researchers working in fields such as immunology, oncology, and cell biology.

NHLRC1 antibody was raised in Rabbit using Human NHLRC1 as the immunogen

NDUFA6 antibody was raised in Rabbit using Human NDUFA6 as the immunogen

Rabbit polyclonal CIB3 antibody

The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.

The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.

The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.

ENTPD4 antibody was raised in Rabbit using Human ENTPD4 as the immunogen

MYEF2 antibody was raised in Rabbit using Human MYEF2 as the immunogen

NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids  TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC

Rabbit polyclonal PIGO antibody

KCNIP3 antibody was raised in Rabbit using Human KCNIP3 as the immunogen

Affinity purified Rabbit polyclonal C1orf165 antibody

NDUFA9 antibody was raised in Rabbit using Human NDUFA9 as the immunogen

Affinity purified Rabbit polyclonal BAIAP2L1 antibody

The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.

Affinity purified Rabbit polyclonal FBXL12 antibody

Affinity purified Rabbit polyclonal RBM15 antibody

Affinity purified Rabbit polyclonal Syntrophin alpha 1 antibody

RIPK2 antibody was raised in rabbit using the middle region of RIPK2 as the immunogen

DOK7 antibody was raised in rabbit using the C terminal of DOK7 as the immunogen

RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS

Affinity purified Rabbit polyclonal TNFAP1 antibody

CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.

The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to

Affinity purified Rabbit polyclonal DUSP8 antibody

Affinity purified Rabbit polyclonal PEF1 antibody

The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.

EBAG9 antibody was raised in Rabbit using Human EBAG9 as the immunogen

The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.

Affinity purified Rabbit polyclonal NCKAP1 antibody

The IL8 antibody is a highly specific antibody used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody targets IL8, which is an important chemokine involved in inflammation and immune responses. The IL8 antibody can be used for various applications, including immunohistochemistry, flow cytometry, and ELISA. It has been extensively validated and shows high sensitivity and specificity in detecting IL8 in various samples. The IL8 antibody is produced using advanced techniques to ensure high purity and activity. It is supplied as a buffered solution for easy handling and storage. Whether you are studying autoimmune diseases or investigating the role of IL8 in cancer development, the IL8 antibody is a valuable tool for your research needs.

The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.

Rabbit polyclonal EPHB2 antibody (Tyr298)

CD38 antibody (Allophycocyanin) was raised in rat using CD38 as the immunogen.

Rabbit polyclonal URM1 antibody

SOCS1 antibody was raised using the N terminal of SOCS1 corresponding to a region with amino acids RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA

The MDMA antibody is a monoclonal antibody that is used in Life Sciences research. It has the ability to specifically bind to MDMA (3,4-methylenedioxymethamphetamine), commonly known as ecstasy. This antibody can be used for various applications, such as detecting MDMA in biological samples or studying its effects on different systems.

The Aldolase antibody is a highly specialized protein used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets various proteins, including caspase-9, endonuclease, and β-catenin, among others.

MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.