Anticorps primaires

The HES1 antibody is a highly activated monoclonal antibody used in Life Sciences research. It specifically targets and binds to HES1, a protein involved in various cellular processes. This antibody has been shown to inhibit the activity of interferon-gamma (IFN-γ), glutamate, and interleukin-6 (IL-6) signaling pathways. Additionally, it can be used for the visualization of actin filaments in cells due to its high specificity towards actin. The HES1 antibody has a high viscosity, making it ideal for applications that require long-term stability and minimal sample loss. Furthermore, this antibody exhibits cytotoxic effects on targeted cells, making it a valuable tool for studies involving cell viability and apoptosis.

Goat polyclonal AFP antibody (Ig fraction)

The NMDAR1 antibody is a monoclonal antibody that targets the N-methyl-D-aspartate receptor subtype 1 (NMDAR1). This receptor is involved in various physiological processes, including synaptic plasticity and learning. The NMDAR1 antibody has been shown to inhibit the activation of NMDAR1 and reduce microvessel density in tumors by blocking the binding of growth factors to their receptors. It has also been demonstrated to modulate the expression of histidine, epidermal growth factor, and steroid receptors in granulosa cells. In addition, this antibody can activate e-cadherin and β-catenin signaling pathways, which are important for cell adhesion and migration. Overall, the NMDAR1 antibody offers promising applications in life sciences research and provides valuable insights into cellular mechanisms related to growth and development.

This antibody reacts with heavy chains on human IgG (gamma chain).

Rabbit polyclonal NOP2 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This active compound has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.

BAI1 antibody was raised in rabbit using a synthetic peptide conjugated to KLHd as the immunogen.

CD117 antibody (CY5) was raised in rat using murine CD117/c-Kit as the immunogen.

NUP153 antibody was raised in mouse using nuclear matrix protein fraction prepared from rat liver nuclei as the immunogen.

Rabbit polyclonal elF4E antibody (Ser209)

The beta Actin antibody is a powerful tool used in the field of Life Sciences for various applications. This antibody specifically targets the beta-actin protein, which plays a crucial role in cellular processes such as cell motility and structure. It is widely used in research to study the expression and localization of beta-actin in different cell types and tissues.

The MKK3 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to alpha-fetoprotein, a glycoprotein that plays a crucial role in various biological processes. This antibody can be used in a variety of assays, including immunohistochemistry and Western blotting, to detect and quantify the presence of alpha-fetoprotein in samples.

FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

Rabbit polyclonal ADORA2B antibody

DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Extensive research has demonstrated its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, hindering cell growth in culture.

The PLVAP antibody is a glycopeptide that belongs to the class of antibodies used in Life Sciences. It is specifically designed to target and bind to PLVAP (Plasmalemma Vesicle-Associated Protein), an important protein involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.

ACTR10 antibody was raised in Rabbit using Human ACTR10 as the immunogen

Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Rabbit polyclonal SNX19 antibody

The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.

The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro

DCX antibody was raised in Rabbit using Human DCX as the immunogen

The Caspase 8 antibody is a polyclonal antibody used in life sciences. It specifically targets caspase 8, a cysteine-rich protein that plays a crucial role in apoptosis (programmed cell death). This glycoprotein is an important regulator of cell survival and death pathways. The Caspase 8 antibody can be used for various applications, including western blotting, immunohistochemistry, and flow cytometry.

The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.

PLP1 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It specifically targets and binds to PLP1, a protein expressed in cardiomyocytes. This antibody has been shown to modulate mitogen-activated protein kinase (MAPK) signaling pathway, which plays a crucial role in cell growth and differentiation. Additionally, PLP1 antibody can be used in Life Sciences research as a tool for studying the functions of PLP1 and its implications in various physiological processes. This monoclonal antibody is highly specific and exhibits high affinity for PLP1, making it an ideal choice for experiments requiring precise targeting of this protein. Furthermore, PLP1 antibody has been validated for use in human serum samples and has shown activation of protein kinase pathways.

The BCL2 antibody is a monoclonal antibody that specifically targets the BCL2 protein. This protein is involved in regulating cell death and has been implicated in various diseases, including cancer and neurodegenerative disorders. The BCL2 antibody is reactive and neutralizing, meaning it can bind to the BCL2 protein and prevent its activity.

CD45 antibody (Allophycocyanin) was raised in mouse using chicken CD45 as the immunogen.

Rabbit polyclonal APC5 antibody

Affinity purified Rabbit polyclonal SERPINA10 antibody

The PFK antibody is a highly specialized polymerase enzyme that acts as a neutralizing agent. It is a monoclonal antibody specifically designed to target collagen and inhibit its activity. This antibody has shown great potential in the field of Life Sciences, particularly in research related to TGF-beta1, albumin, phosphatase, growth factors, interferon, glutamate, and dopamine. Its unique mechanism of action makes it an invaluable tool for studying various biological processes and pathways. Whether you're conducting experiments or exploring new therapeutic avenues, the PFK antibody is sure to be an asset in your scientific endeavors.

The SNAP25 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used to detect and analyze the presence of SNAP25, a target molecule involved in various cellular processes. This antibody can be used in research applications such as immunohistochemistry, Western blotting, and flow cytometry.

PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ

Mouse monoclonal TBC1D21 antibody

Mouse monoclonal SCHIP1 antibody

CTSD antibody was raised in Rabbit using Human CTSD as the immunogen

GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW

Neu antibody was raised in mouse using tyrosine-phosphorylated synthetic peptide corresponding to amino acids 1242-1255 from the C-terminus of human c-erbB-2 protein. as the immunogen.

CCRL1 antibody was raised in rabbit using the C terminal of CCRL1 as the immunogen

RAB34 antibody was raised in rabbit using the C terminal of RAB34 as the immunogen

ABCE1 antibody was raised in Rabbit using Human ABCE1 as the immunogen

The TACC3 antibody is a highly specialized monoclonal antibody that has receptor binding capabilities. It acts as a phosphatase, neutralizing specific targets in the body. This antibody is widely used in Life Sciences research and has shown promising results in various studies. It has been found to have an inhibitory effect on alpha-fetoprotein, a protein found in human serum that is associated with certain diseases. The TACC3 antibody can also block the activity of angptl3, a chemokine involved in inflammatory processes. With its immunosuppressant properties, this monoclonal antibody holds great potential for therapeutic applications and further exploration in the field of medicine.

Affinity purified Rabbit polyclonal MAPK1/3 antibody

APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT

The GLUT4 antibody is a polyclonal antibody used in the life sciences field. It specifically targets binding proteins involved in the regulation of glucose transport. This antibody has been extensively tested and validated for its specificity and sensitivity. It has been shown to effectively detect GLUT4 expression in various tissues and cell types.

Complement C9 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of complement C9. This antibody has been shown to have potent cytotoxic effects on cancer cells, making it a promising candidate for targeted cancer therapy. In addition, the colloidal nature of this antibody allows for easy administration and distribution throughout the body. Studies have also demonstrated its ability to inhibit β-catenin signaling, which plays a crucial role in tumor growth and metastasis. Furthermore, this antibody has shown potential in treating thrombocytopenia by blocking the activation of platelets. With its high specificity and low toxicity, complement C9 antibody holds great promise in the field of life sciences and may pave the way for new therapeutic approaches in various diseases.

Affinity purified Rabbit polyclonal MAP2K3 antibody

CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.

Purified Polyclonal Beta sarcoglycan antibody

The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.

LAT antibody was raised in Rabbit using Human LAT as the immunogen

The PKNOX1 antibody is a highly specialized monoclonal antibody that targets the PKNOX1 protein. This protein is involved in various cellular processes, including fibrinogen production, cell antigen presentation, and amyloid plaque formation. Additionally, PKNOX1 plays a crucial role as a growth factor and phosphatase regulator.

IFT20 antibody was raised in Rabbit using Human IFT20 as the immunogen

The IFITM1 antibody is a chemokine that plays a crucial role in immune response modulation. It is a polyclonal antibody that specifically targets the proprotein encoded by the IFITM1 gene. This antibody can be used for various applications in life sciences, including research and diagnostic purposes.

Rabbit polyclonal OAS1 antibody

ASPH antibody was raised in Rabbit using Human ASPH as the immunogen

Rabbit polyclonal PSMB9 antibody

SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogen

Rabbit polyclonal HSPA13 antibody

Affinity purified Rabbit polyclonal Laminin gamma 2 antibody

Affinity purified Rabbit polyclonal NMDAR2A antibody

ATP5F1 antibody was raised in Rabbit using Human ATP5F1 as the immunogen

ACYP1 antibody was raised in Rabbit using Human ACYP1 as the immunogen

FBXW11 antibody was raised in Rabbit using Human FBXW11 as the immunogen

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

Rabbit polyclonal Wheat Gliadin antibody

CAT antibody was raised in Rabbit using Human CAT as the immunogen

The FADD antibody is a monoclonal antibody that targets α-syn, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to neutralize the harmful effects of α-syn and reduce its accumulation in the brain. This antibody also inhibits endothelial growth factor and promotes the growth of mesenchymal stem cells, which are involved in tissue repair and regeneration. Additionally, the FADD antibody has been used to measure microvessel density in blood plasma samples using particle chemiluminescence emission. It is a valuable tool for researchers in the field of life sciences studying neurodegenerative diseases and angiogenesis.

Affinity purified Rabbit polyclonal UNC13B antibody

CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.

FBXO8 antibody was raised in Rabbit using Human FBXO8 as the immunogen

CD122 antibody (FITC) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.

Rat thrombocyte antibody was raised in rabbit using rat thrombocytes as the immunogen.

ANAPC4 antibody was raised in Rabbit using Human ANAPC4 as the immunogen

The ENO1 antibody is a specific monoclonal antibody that targets the c-myc protein kinase. It has been shown to inhibit the growth factor signaling pathway and reduce microvessel density in monolayer cultures of MCF-7 cells. This antibody can be used for various applications, including immunohistochemistry, immunofluorescence, and Western blotting. It is highly sensitive and specific, making it an ideal tool for studying the expression and localization of ENO1 in different cell types. Additionally, this antibody has been used to detect autoantibodies against ENO1 in certain diseases, making it a valuable tool for diagnostic purposes. The ENO1 antibody is supplied as a polyclonal antibody and can be used with saponin or TGF-beta for enhanced staining results.

Rat monoclonal CCR7 antibody (allophycocyanin)

Mouse monoclonal HMOX2 antibody

ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA

Affinity purified Rabbit polyclonal ALASE antibody

The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.

Rabbit polyclonal POLR3A antibody

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.