Anticorps primaires

H2AFZ antibody was raised in Rabbit using Human H2AFZ as the immunogen

Rabbit polyclonal SFN antibody

Rabbit polyclonal FUCA2 antibody

WDR23 antibody was raised using the N terminal of WDR23 corresponding to a region with amino acids GSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLR

Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.

The Annexin A3 antibody is an essential antibody-drug that plays a crucial role in various biological processes. It specifically targets and binds to Annexin A3, a protein involved in glucagon receptor binding and antigen presentation. This antibody is available in both polyclonal and monoclonal forms, offering versatility for different research applications.

Affinity purified Rabbit polyclonal UFD1L antibody

HPSE antibody was raised in rabbit using the N terminal of HPSE as the immunogen

The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.

Rabbit polyclonal Ephrin B antibody

ZFYVE27 antibody was raised using the C terminal of ZFYVE27 corresponding to a region with amino acids TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC

Rabbit polyclonal Cathepsin F antibody (HRP)

HSDL2 antibody was raised in Rabbit using Human HSDL2 as the immunogen

PDAP1 antibody was raised using the N terminal of PDAP1 corresponding to a region with amino acids MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD

NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ

The SYT1 antibody is a highly effective polyclonal antibody that targets angptl3, a glycoprotein involved in various biological processes. This antibody can be used in chromatographic techniques for protein purification and immobilization, making it an essential tool in life sciences research. Additionally, the SYT1 antibody has neutralizing properties against inhibitors of growth factors, such as collagen, making it a valuable asset in cytotoxic studies. Whether you're conducting experiments or developing therapeutic strategies, the SYT1 antibody is a reliable choice for your research needs.

LAT2 antibody was raised in Rabbit using Human LAT2 as the immunogen

The MARK4 antibody is a polyclonal antibody that is used in life sciences research. It is specifically designed to target and bind to the MARK4 protein, which plays a crucial role in various cellular processes. This antibody can be used for molecular docking studies, as well as for the detection and quantification of MARK4 in biological samples.

Affinity purified Rabbit polyclonal GLE1 antibody

Rabbit polyclonal RPH3A antibody (ser234)

Rabbit polyclonal UNC5D antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is known for its potent bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth and prevents transcription and replication. This active compound has been extensively studied using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it exhibits high efficacy against Mycobacterium tuberculosis strains. Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis infection.

Affinity purified Rabbit polyclonal CAPZB antibody

The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.

The NTR1 antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to NTR1, a protein that plays a crucial role in various biological processes. This antibody can be used for immobilization purposes, such as in immunoassays or for the detection of NTR1 in human serum samples.

Sheep polyclonal DNM1 antibody (Ser778)

The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.

ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

DLAT antibody was raised in Rabbit using Human DLAT as the immunogen

HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen

Rabbit polyclonal PPP1R11 antibody (FITC)

KYNU antibody is a polyclonal antibody that specifically targets kynureninase (KYNU), an enzyme involved in the metabolism of tryptophan. KYNU plays a crucial role in the production of kynurenic acid, which has been implicated in various neurological and psychiatric disorders. This antibody can be used in research assays to detect and quantify KYNU levels in biological samples, allowing for a better understanding of its function and potential therapeutic applications. With its high specificity and sensitivity, the KYNU antibody is a valuable tool for scientists and researchers working in the field of life sciences. Whether studying autoimmune diseases, developing new medicines, or exploring the role of kynurenine pathway intermediates, this antibody provides reliable results and contributes to advancements in biomedical research.

The BCL2L1 antibody is a monoclonal antibody that specifically targets the alpha-fetoprotein (AFP), a biomarker associated with various diseases including cancer. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in detecting and quantifying AFP levels in human serum samples. The BCL2L1 antibody binds to AFP with high affinity, making it an ideal tool for diagnostic purposes. Additionally, this antibody has also been used in research studies to investigate the role of AFP in cholinergic signaling, epidermal growth factor (EGF) signaling, and β-catenin activation. Its versatility and specificity make the BCL2L1 antibody a valuable tool for scientists and researchers working in diverse fields such as oncology, immunology, and molecular biology.

Rabbit polyclonal RASD2 antibody

Rabbit polyclonal Mammaglobin B antibody

ATP5F1 antibody was raised in Rabbit using Human ATP5F1 as the immunogen

Rabbit polyclonal Ephrin A4 antibody

Transferrin antibody was raised in rabbit using rat transferrin as the immunogen.

Mouse monoclonal Influenza A haemagglutinin H1 antibody

Mouse monoclonal gp64 antibody (allophycocyanin)

Albumin antibody was raised in Mouse using Human albumin as the immunogen.

KLRG1 antibody (biotin) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.

CD38 antibody was raised in Mouse using a purified recombinant fragment of human CD38 expressed in E. coli as the immunogen.

The DDC antibody is a powerful tool in the field of Life Sciences. It is an antibody that can be used for various applications, including research and diagnostic purposes. This antibody is highly specific and can recognize and bind to a target protein called DDC (dopa decarboxylase). DDC is an enzyme that plays a crucial role in the synthesis of important neurotransmitters like dopamine.

The GATA1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets GATA1, a transcription factor involved in the regulation of gene expression. This antibody can be used to study various cellular processes, including cell differentiation, proliferation, and apoptosis. The GATA1 antibody has been shown to have cytotoxic effects on certain cancer cells and can also modulate the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. Additionally, this antibody has been used in research related to β-catenin signaling pathway and growth factors. Whether you are studying antiviral mechanisms or nuclear signaling events, the GATA1 antibody is an essential tool for your research needs.

The PAX6 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to target and neutralize the PAX6 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and validated in Life Sciences research, making it a reliable tool for scientists and researchers. It can be used in experiments involving adipose tissue, nuclear signaling pathways, and other cellular processes where PAX6 is involved. The PAX6 antibody is also available as polyclonal antibodies for different applications, including the detection of chemokines, angptl3 inhibitors, and alpha-fetoprotein. With its high specificity and effectiveness, this antibody is an essential tool for studying PAX6-related mechanisms and exploring their potential therapeutic applications.

Rabbit polyclonal TBX2 antibody

ACAD9 antibody was raised in Rabbit using Human ACAD9 as the immunogen

RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD

COL8A1 antibody was raised in Rabbit using Human COL8A1 as the immunogen

Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has demonstrated its high efficacy using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug offers a comprehensive approach to tackling Mycobacterium tuberculosis strains. Experience the exceptional potency of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis

Rabbit polyclonal Kinase E9 antibody

The SAMHD1 antibody is a highly specialized monoclonal antibody that specifically targets the SAMHD1 protein. This protein plays a crucial role in regulating the cellular dNTP pool, which is essential for DNA replication and repair. By binding to SAMHD1, this antibody can effectively inhibit its function and disrupt the normal cell cycle.

QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI

The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.

The CCR6 antibody is a powerful tool in the field of life sciences. It is an antibody that specifically targets and binds to the CCR6 protein, which plays a crucial role in various biological processes. The CCR6 antibody can be used for research purposes such as studying the activation of growth factors and tyrosine kinase receptors. It has also been shown to have cytotoxic effects, making it a potential candidate for antibody-drug conjugates.

Shpk antibody was raised in rabbit using the middle region of Shpk as the immunogen

GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Affinity purified Rabbit polyclonal EPH receptor A8 antibody

Rabbit polyclonal USP42 antibody

Affinity purified Rabbit polyclonal Sec61 gamma subunit antibody

MYCBPAP antibody was raised in Rabbit using Human MYCBPAP as the immunogen

The GPX7 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. It is specifically designed to target and neutralize GPX7, an enzyme that plays a crucial role in the regulation of oxidative stress. The antibody has been extensively tested and validated for its efficacy in laboratory experiments.

Affinity purified Rabbit polyclonal RASSF1 antibody

Sheep polyclonal Hydroxyindole antibody

ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen

Rat monoclonal Integrin beta 7 antibody (FITC)

Collagen Type VI Alpha 2 antibody was raised using the C terminal of COL6A2 corresponding to a region with amino acids ARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAI

The ILK antibody is a powerful tool used in scientific research and diagnostics. This monoclonal antibody specifically targets ILK (Integrin-Linked Kinase), a key protein involved in various cellular processes. It plays a crucial role in cell adhesion, migration, proliferation, and survival.

This antibody reacts with heavy (gamma) chains on mouse IgG.

Affinity purified Rabbit polyclonal KRTHA3B antibody

PDLIM1 antibody was raised in rabbit using the middle region of PDLIM1 as the immunogen

The MEK1 antibody is a glycopeptide that targets the growth factor receptor, specifically designed for use in Life Sciences research. This polyclonal antibody has been extensively tested and validated for its high specificity and sensitivity in detecting MEK1 protein. It can be used in various applications such as Western blotting, immunohistochemistry, and immunofluorescence.

Affinity purified Rabbit polyclonal GOLGA3 antibody

Rabbit polyclonal RRAS2 antibody

TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF

The TRIM25 antibody is a biomolecule used in Life Sciences for various applications. It is available as both polyclonal and monoclonal antibodies. The TRIM25 antibody has high specificity and affinity for its target, making it an ideal diagnostic reagent.

The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.

Proteasome 20S antibody was raised in rabbit using a Mixture of synthetic peptides corresponding to residues C R(207) V I L G N/D E L P K F Y D E(220) of human and mouse proteasome 20S LMP2 as the immunogen.

ERLIN2 antibody was raised in Rabbit using Human ERLIN2 as the immunogen

Rabbit polyclonal GRIN2B antibody (Tyr1252)

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.