Anticorps primaires

Affinity purified Rabbit polyclonal Calpain 1 antibody

HSBP1 antibody was raised in Rabbit using Human HSBP1 as the immunogen

Protein C antibody (HRP) was raised in sheep using human Protein C purified from plasma as the immunogen.

Affinity purified Rabbit polyclonal CCDC83 antibody

The Caspase 9 antibody is a polyclonal antibody that specifically targets the caspase-9 protein. This antibody has been shown to have neutralizing properties and can effectively inhibit the activity of caspase-9. Caspase-9 plays a crucial role in apoptosis, or programmed cell death, by initiating the cascade of events that lead to cell death. By targeting caspase-9, this antibody can help regulate cell growth and survival.

Affinity purified Rabbit polyclonal ALOX5 antibody

SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Rabbit polyclonal Cystatin C antibody (biotin)

The CD38 antibody is a highly specialized monoclonal antibody that binds to CD38, a protein found on the surface of certain cells. This antibody has cytotoxic properties and can be used in various applications, including research and diagnostics. It specifically targets CD38-expressing cells and can be used to study their function or as a therapeutic agent.

Rabbit polyclonal COX5A antibody (FITC)

C20ORF3 antibody was raised using the C terminal Of C20Orf3 corresponding to a region with amino acids QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL

Rabbit polyclonal TSC22D4 antibody

Purified Polyclonal ABCC13 antibody

Rabbit polyclonal Ephrin B antibody (Tyr330)

Sigma 54 Monoclonal Antibody

Rabbit polyclonal GRIN2A antibody (Tyr1325)

Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections by inhibiting bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for treating respiratory disorders caused by bacteria such as Clostridium perfringens. By binding to the ribosomal subunit, Tilmicosin effectively inhibits bacterial growth. Studies have shown that Tilmicos

The Lamin B2 antibody is a highly specialized antibody that targets autoantibodies in cardiomyocytes. It is also effective against anti-mesothelin antibodies. This antibody plays a crucial role in the field of Life Sciences and medicine, as it serves as a serum marker for various diseases and conditions. The Lamin B2 antibody has been shown to interact with dopamine, which is involved in numerous physiological processes. Additionally, this antibody has the ability to activate methyltransferase enzymes and modulate interleukin levels. Furthermore, it influences the release of acetylcholine and regulates transmembrane conductance. With its unique properties and high specificity, the Lamin B2 antibody is an essential tool for researchers and healthcare professionals alike.

Affinity purified Rabbit polyclonal SFMBT1 antibody

INS antibody was raised in Rabbit using Human INS as the immunogen

ENPP6 antibody was raised in Rabbit using Human ENPP6 as the immunogen

ATP6V1G2 antibody was raised in rabbit using the middle region of ATP6V1G2 as the immunogen

Goat anti-cat IgG was raised in goat using feline IgG F(ab')2 fragment as the immunogen.

The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.

Transferrin antibody was raised in rabbit using rat transferrin as the immunogen.

The Albendazole antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and monoclonal antibodies, which are widely used as inhibitors in various research applications. This antibody specifically targets endothelial growth factor, making it a valuable tool for studying angiogenesis and related processes.

C16orf70 antibody was raised in Rabbit using Human C16orf70 as the immunogen

Rabbit polyclonal GPR160 antibody

Mouse IgE antibody was raised in rat using murine IgE as the immunogen.

MCM4 antibody was raised in Rabbit using Human MCM4 as the immunogen

Affinity purified Rabbit polyclonal BCL2L12 antibody

Rabbit polyclonal IP3KC antibody

SCARB2 antibody was raised in rabbit using the N terminal of SCARB2 as the immunogen

CD34 Monoclonal Antibody (RPE)

Affinity purified Rabbit polyclonal Caspase 10 antibody

The Fatty Acid Synthase antibody is a highly specialized protein used in Life Sciences research. It is an essential tool for studying the role of fatty acid synthesis in various biological processes. This antibody specifically targets and neutralizes proteins involved in the synthesis of fatty acids, such as TNF-α, interleukin-6, and chemokines.

The SERPINF2 antibody is a highly effective neutralizing agent that has been extensively studied in various scientific fields, including Life Sciences. It is a monoclonal antibody that has shown promising results in inhibiting the activity of SERPINF2, a protein involved in adipose tissue regulation. Through electrochemical impedance spectroscopy, it has been demonstrated that this antibody effectively binds to SERPINF2 and prevents its interaction with other molecules in the reaction solution.

CD28 antibody was raised in mouse using chicken CD28 as the immunogen.

Rabbit polyclonal GABRA5 antibody

The ARPC2 antibody is a growth factor that plays a crucial role in various cellular processes. It is a monoclonal antibody specifically designed to target and neutralize anti-dnp antibodies. The ARPC2 antibody has been extensively studied and proven effective in laboratory experiments using electrodes. Additionally, it has shown promising results in combination therapy with other antibodies such as trastuzumab, targeting the epidermal growth factor receptor.

The EFNA4 antibody is a monoclonal antibody that targets autoantibodies against the EFNA4 protein. This protein is involved in various biological processes, including cell adhesion and migration. The EFNA4 antibody can be used in research and diagnostic applications to detect the presence of autoantibodies in human serum.

The SNAP23 antibody is a monoclonal antibody that specifically targets the protein SNAP23. This protein plays a crucial role in various cellular processes, including vesicle fusion and membrane trafficking. The SNAP23 antibody can be used in Life Sciences research to study the function of SNAP23 and its interactions with other proteins.

Rabbit polyclonal U1A antibody (biotin)

Affinity purified Rabbit polyclonal Dipeptidyl peptidase 3 antibody

MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE

LPHN3 antibody was raised in Rabbit using Human LPHN3 as the immunogen

CD8 antibody (Spectral Red) was raised in mouse using human CD8 as the immunogen.

Rabbit polyclonal PIP5K3 antibody

FCER1A antibody was raised using the N terminal of FCER1A corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK

CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV

Rabbit polyclonal GNAL antibody

TPH1 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the enzyme tryptophan hydroxylase 1 (TPH1), which is responsible for the conversion of tryptophan to serotonin in the brain and peripheral tissues. This antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. TPH1 antibody has been shown to have high specificity and sensitivity in detecting TPH1 protein expression in liver microsomes. It can also be used to study the role of TPH1 in various biological processes, such as neuronal development, mood regulation, and serotonin synthesis. Additionally, this antibody has been used in studies investigating the involvement of TPH1 in diseases like depression, anxiety disorders, and Parkinson's disease. With its wide range of applications and reliable performance, TPH1 antibody is an essential tool for researchers studying serotonin metabolism and related pathways.

FLAG antibody was raised in Mouse using synthetic peptide corresponding to aa(DYKDDDDK), conjugated to KLH as the immunogen.

Rabbit polyclonal CKMT antibody (biotin)

DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVA

Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC

AKAP10 antibody was raised in Rabbit using Human AKAP10 as the immunogen

Affinity purified Rabbit polyclonal LIM kinase 2 antibody

DBP antibody was raised in mouse using recombinant Albumin D-Box Binding Protein

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp techniques, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The FAK antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody plays a crucial role in various biological processes, including fatty acid metabolism, insulin signaling, and fibrinogen binding. It is designed to specifically target and bind to focal adhesion kinase (FAK), an important protein involved in cell adhesion and migration.

CNKSR1 antibody was raised in Rabbit using Human CNKSR1 as the immunogen

Sheep polyclonal Hydroxyindole antibody

Affinity purified Rabbit polyclonal Annexin A6 antibody

Affinity purified Mouse polyclonal HOXA6 antibody

FLCN antibody was raised in rabbit using the N terminal of FLCN as the immunogen

Complement C5 antibody was raised in mouse using human complement component C5 as the immunogen.

CHCHD6 antibody was raised in rabbit using the middle region of CHCHD6 as the immunogen

The ZHX2 antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to neutralize lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody can be used as a research tool to study the function and regulation of lipoprotein lipase in various biological systems.

BUB3 antibody was raised in Rabbit using Human BUB3 as the immunogen

Mouse monoclonal PGAM2 antibody

This antibody reacts with heavy (gamma) chains on mouse IgG.

Mouse monoclonal CD20 antibody (biotin)

Affinity purified Chicken polyclonal Beta Tubulin 3 antibody

Rabbit polyclonal VTN antibody

ZNF624 antibody was raised in rabbit using the middle region of ZNF624 as the immunogen

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.