Anticorps primaires

The AQP3 antibody is a spectrometric monoclonal antibody that is used in Life Sciences research. It specifically targets the aquaporin-3 (AQP3) protein, which plays a crucial role in water and glycerol transport across cell membranes. This antibody has been extensively studied and validated for its ability to detect AQP3 in various samples, including human serum.

The Caspase 6 antibody is a highly specialized immunoassay tool designed for neutralizing the activity of Caspase 6, a drug antibody that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth factor signaling pathway mediated by Caspase 6. Additionally, it has shown promising results as a potential therapeutic agent for diseases involving abnormal cell proliferation.

DMWD antibody was raised in Rabbit using Human DMWD as the immunogen

Mouse monoclonal PECR antibody

Mouse RBC antibody (Texas Red) was raised in rabbit using mouse erythrocytes as the immunogen.

Affinity purified Rabbit polyclonal BCLx antibody

The SLK antibody is a growth factor that plays a crucial role in various biological processes. It is a colloidal glycosylation antibody that can be used for research purposes in the Life Sciences field. This antibody specifically targets insulin, a protein involved in regulating glucose metabolism. The SLK antibody can be used in assays to detect and quantify insulin levels in samples. It is also commonly used as a tool for studying insulin signaling pathways and investigating the function of insulin in different cellular processes. Additionally, this antibody can be used to activate alkaline phosphatases and detect monoclonal antibodies or anti-ACTH antibodies. Its versatility and specificity make it an essential tool for researchers in the Life Sciences field.

The SAP130 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This antibody specifically targets the SAP130 protein, which is involved in the regulation of gene expression and chromatin remodeling. By binding to SAP130, this antibody can modulate the activity of calmodulin, an important calcium-binding protein.

The SH1 antibody is a polyclonal antibody that has been developed as a potential biological tool for studying tumor biomarkers. It specifically targets the IL-17A antigen, which is known to be involved in various protein-protein interactions and signaling pathways. The SH1 antibody can be used in various life science applications, including immunohistochemistry, western blotting, and ELISA assays. It has been shown to exhibit strong inhibition effects on IL-17A activity in vitro and in vivo. The SH1 antibody is produced using a eukaryotic expression vector and synthetic techniques, ensuring high purity and specificity. With its unique characteristics and versatility, the SH1 antibody is an essential tool for researchers investigating IL-17A-related pathways and exploring potential therapeutic interventions.

The DLST antibody is a highly specialized product that is essential for various research and laboratory applications in the field of Life Sciences. This antibody specifically binds to DLST, which stands for Dihydrolipoamide S-Succinyltransferase, an important enzyme involved in cellular metabolism.

CD152 antibody (Azide free) was raised in hamster using murine CD152/CTLA-4 as the immunogen.

Mouse monoclonal ZIM2 antibody

Connexin 43 antibody is a glycoprotein that plays a crucial role in cell communication. It is commonly used in life sciences research as a tool to study the function of connexin proteins. This polyclonal antibody specifically targets connexin 43, which is one of the most abundant connexin isoforms found in various tissues and organs.

The DGKA antibody is a highly specialized product in the field of Life Sciences. It is a colloidal inhibitory factor that targets cardiomyocytes. This antibody has been shown to have natriuretic effects when activated, making it a valuable tool for research in cardiovascular physiology. Additionally, the DGKA antibody has been found to possess autoantibodies against annexin A2, which further expands its potential applications. This product is available as a monoclonal antibody and can be used in various experimental setups. It can be conveniently detected using streptavidin-based detection systems and has neutralizing properties that make it suitable for functional studies. Researchers interested in glucagon-related pathways will find this DGKA antibody an indispensable tool for their investigations.

The CAD antibody is a monoclonal antibody that specifically targets fatty acid and protein biomarkers. It is commonly used in immunoassay tests to detect the presence of these biomarkers in various samples. The reactive nature of this antibody makes it a potential biomarker for research in the Life Sciences field.

The PUMA antibody is a powerful tool in the field of Life Sciences. It is an autoantibody that specifically targets and neutralizes the activity of PUMA (p53 upregulated modulator of apoptosis) protein. PUMA plays a crucial role in regulating cell death and is involved in various physiological processes, including embryonic development, tissue homeostasis, and immune response.

This antibody reacts with heavy chains on human IgE (epsilon chain).

Rabbit polyclonal VASP antibody (Ser157)

Affinity purified Rabbit polyclonal HSD17B6 antibody

The H2B antibody is a polyclonal antibody that has neutralizing properties. It is used in the field of Life Sciences to study various aspects of cellular biology. This antibody specifically targets the interferon-gamma (IFN-gamma) pathway, which plays a crucial role in immune responses and viral infections. The H2B antibody can be used to detect and quantify virus surface antigens, as well as nuclear proteins involved in gene regulation. Additionally, this antibody has been shown to interact with fatty acid-binding proteins and serine proteases, suggesting its involvement in lipid metabolism and protein processing pathways. Whether you need a monoclonal or polyclonal antibody for your research, the H2B antibody is a reliable tool that provides accurate and reproducible results.

The KLK5 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as an inhibitor of endothelial growth factor, acidic neurotrophic factor, and colloidal antibodies. Additionally, it has neutralizing properties against glucagon and tyrosine growth factor.

AMH antibody was raised in Rabbit using Human AMH as the immunogen

The GMCSF antibody is a highly specialized protein used in the field of Life Sciences. It is commonly used in research and diagnostic applications. This antibody plays a crucial role in regulating the growth and development of various cells in the body, including white blood cells.

ATIC antibody was raised in Rabbit using Human ATIC as the immunogen

The EMR1 antibody is a polyclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and neutralize glutamate, an important neurotransmitter in the human body. This antibody has been shown to have high affinity and specificity for its target, making it an effective tool for researchers studying glutamate-related processes.

CDH23 antibody was raised in Rabbit using Human CDH23 as the immunogen

Mouse monoclonal CD34 antibody (PE)

The CD27 antibody is a neutralizing monoclonal antibody that targets the CD27 protein. CD27 is a cell surface receptor that plays a crucial role in immune responses and lymphocyte activation. This antibody binds to CD27, preventing its interaction with other molecules and inhibiting downstream signaling pathways. It has been shown to inhibit the activity of glutamate phosphatase and block the production of autoantibodies. The CD27 antibody can be used in various research applications in the field of life sciences, including immunology and cell biology. It is commonly used in experiments involving activated lymphocytes, as well as in studies investigating cytotoxicity and growth factors. This high-quality monoclonal antibody is produced using advanced techniques and has been extensively tested for specificity and functionality. Its purity and reliability make it an excellent choice for researchers seeking accurate and reproducible results.

Rat monoclonal CD150 antibody (biotin)

Goat anti-human IgG (Fab'2) was raised in goat using human IgG F(c) fragment as the immunogen.

NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH

The Caspase 2 antibody is a cytotoxic monoclonal antibody that targets the Caspase 2 protein. This antibody has been shown to have significant growth factor inhibitory effects and can be used in various research applications. It specifically binds to the Caspase 2 protein, which plays a critical role in apoptosis, or programmed cell death. The antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting experiments to study the expression and localization of Caspase 2 in different tissues and cell types. Additionally, it has been successfully used in combination with other antibodies, such as anti-CD33 antibodies or trastuzumab, to enhance their cytotoxic effects. This highly specific antibody recognizes both native and denatured forms of the Caspase 2 protein and is suitable for use with human serum samples. Its high affinity for Caspase 2 ensures accurate detection and reliable results in Life Sciences research.

Affinity purified Rabbit polyclonal GADD45 gamma antibody

Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ

Chicken polyclonal MTBE antibody

Affinity purified Rabbit polyclonal LRP130 antibody

Cytokeratin 10 antibody is a monoclonal antibody that specifically targets and binds to cytokeratin 10, a protein found in epithelial cells. This antibody is commonly used in life sciences research to study the expression and localization of cytokeratin 10 in various tissues and cell types. Cytokeratin 10 plays a crucial role in maintaining the structural integrity of epithelial cells and is involved in cell adhesion, migration, and differentiation processes. By targeting cytokeratin 10, this antibody enables researchers to gain valuable insights into the cellular mechanisms underlying tissue development, wound healing, and diseases such as cancer. With its high specificity and sensitivity, the cytokeratin 10 antibody is an essential tool for scientists investigating the complex functions of epithelial cells in both normal and pathological conditions.

The VEGFD antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitor against TGF-β1 and chemokine, making it an essential component in various research studies. This monoclonal antibody has shown inhibitory properties against protein kinase, insulin, and natriuretic factors. Its unique design allows for precise targeting and binding to specific molecules, ensuring accurate results in immunoassays. With its ability to neutralize interferon activity, the VEGFD antibody opens up new possibilities for studying neurotrophic factors and their role in different biological processes. Researchers can rely on this high-quality antibody to enhance their experiments and gain valuable insights into cellular mechanisms.

Rabbit polyclonal Lambda light chain antibody

Rabbit polyclonal OR10J6 antibody

ATXN10 antibody was raised in Rabbit using Human ATXN10 as the immunogen

NR4A1 antibody was raised using the middle region of NR4A1 corresponding to a region with amino acids FQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHL

Affinity purified Rabbit polyclonal EIF3K antibody

EIF2S3 antibody was raised in Rabbit using Human EIF2S3 as the immunogen

Rabbit polyclonal Major capsid protein L1 antibody

Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen

IL1b antibody was raised in rabbit using recombinant human IL-1b as the immunogen.

Rabbit polyclonal TAX1BP3 antibody (HRP)

Affinity purified Rabbit polyclonal Myotubularin related protein 4 antibody

The Cox2 antibody is a growth factor that targets a specific cell antigen known as endothelial growth. It belongs to the category of polyclonal antibodies and is widely used in the field of Life Sciences. This antibody has been shown to have interactions with various proteins, including fibrinogen, lipoprotein lipase, and amyloid plaque. Additionally, it can inhibit the activity of lipase and phosphatase enzymes. The Cox2 antibody is available in both polyclonal and monoclonal forms, making it suitable for different research purposes. It is often used to detect autoantibodies or as a tool for studying triglyceride lipase activity. With its versatile applications, this antibody is an essential tool for researchers in various fields.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.

Rabbit polyclonal RBBP6 antibody

Affinity purified Rabbit polyclonal YKL39 antibody

Rabbit polyclonal PCDHB15 antibody

Goat polyclonal Pseudomonas aeruginosa Exotoxin A antibody

FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids QTLQDRTEKMKEIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPE

MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE

Rabbit polyclonal PRPF4 antibody

BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Affinity purified Rabbit polyclonal AIF1 antibody

The CD82 antibody is a powerful tool in the field of Life Sciences. It acts as a phosphatase that regulates various cellular processes by binding to specific proteins. This antibody has been shown to inhibit the production of interleukin-6, a pro-inflammatory cytokine involved in immune responses. Additionally, it can be used in antigen-antibody reactions to detect the presence of autoantibodies in patient samples.

Rabbit polyclonal Ephrin A4 antibody

Rabbit polyclonal DDX39B antibody (FITC)

Mouse monoclonal Influenza A haemagglutinin H1 antibody

Affinity purified Rabbit polyclonal GPRC6A antibody

Mouse monoclonal CD45.2 antibody (PE)

The FZD6 antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor receptor (IGF-1R). It is designed to specifically bind to the IGF-1R and inhibit its activity. This antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for various diseases, including cancer.

Rabbit polyclonal STX11 antibody

The DDC antibody is a powerful tool in the field of Life Sciences. It is an antibody that can be used for various applications, including research and diagnostic purposes. This antibody is highly specific and can recognize and bind to a target protein called DDC (dopa decarboxylase). DDC is an enzyme that plays a crucial role in the synthesis of important neurotransmitters like dopamine.

MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL

The PAX6 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to target and neutralize the PAX6 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and validated in Life Sciences research, making it a reliable tool for scientists and researchers. It can be used in experiments involving adipose tissue, nuclear signaling pathways, and other cellular processes where PAX6 is involved. The PAX6 antibody is also available as polyclonal antibodies for different applications, including the detection of chemokines, angptl3 inhibitors, and alpha-fetoprotein. With its high specificity and effectiveness, this antibody is an essential tool for studying PAX6-related mechanisms and exploring their potential therapeutic applications.

USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD

ACAD9 antibody was raised in Rabbit using Human ACAD9 as the immunogen

The DDX24 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically binds to nuclear binding proteins. This monoclonal antibody is highly activated and can be used for various applications in research and medicine.

Rabbit polyclonal RPL6 antibody

Affinity purified Rabbit polyclonal HICE1 antibody

The B7H4 antibody is a highly effective medicament that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for its remarkable properties. The antibody complex specifically targets and binds to B7H4, a protein expressed on the surface of various cancer cells, including MDA-MB-231 breast cancer cells. This binding inhibits the growth and proliferation of cancer cells by interfering with their signaling pathways.

ATP5D antibody was raised in Rabbit using Human ATP5D as the immunogen

CD38 antibody (Allophycocyanin) was raised in rat using CD38 as the immunogen.

Rabbit polyclonal ZNF774 antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.