Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
75602 produits trouvés pour "Anticorps primaires"
Mouse Lymphocyte antibody
Mouse Lymphocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.
Degré de pureté :Min. 95%SIVA1 antibody
The SIVA1 antibody is a highly specific monoclonal antibody that targets the biomolecule SIVA1. It is derived from isolated nucleic acids and collagen, making it a powerful tool for research in the field of Life Sciences. The SIVA1 antibody has been developed using cell hybridomas and chromatographic techniques to ensure high purity and specificity. It binds to hyaluronan receptors on the cell-extracellular matrix interface, allowing for precise detection and analysis of SIVA1 in various biological samples. This specific antibody can be used in applications such as immunohistochemistry, Western blotting, and ELISA assays to study the function and expression of SIVA1 in different cellular contexts. With its exceptional sensitivity and selectivity, the SIVA1 antibody is an invaluable asset for scientists seeking to unravel the complexities of cellular signaling pathways and protein interactions.
Fibrinogen antibody
Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.Degré de pureté :Min. 95%SAA4 antibody
SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF
Degré de pureté :Min. 95%Natalizumab
CAS :Monoclonal antibody against α4-integrin
Formule :C40H55N7O11SDegré de pureté :Min. 95%Masse moléculaire :841.97Tetraspanin 32 antibody
Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD
