Anticorps primaires

Rat monoclonal TRANCE antibody (PE)

UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

Rabbit polyclonal IKBE antibody (Ser22)

ANXA5 antibody was raised in Rabbit using Human ANXA5 as the immunogen

The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.

CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.

FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH

FN3KRP antibody was raised using the N terminal of FN3KRP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA

VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.

MIP1 beta antibody (biotin) was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.

DUSP15 antibody was raised in Rabbit using Human DUSP15 as the immunogen

GFP antibody (HRP) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.

SLPI antibody was raised in rabbit using the N terminal of SLPI as the immunogen

CD19 antibody (PE) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.

RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG

The Cytokeratin 19 antibody is a highly effective polyclonal antibody that targets and binds to Cytokeratin 19, a protein that plays a crucial role in cell adhesion and differentiation. This antibody has been extensively tested and proven to be reliable in detecting the presence of Cytokeratin 19 in various biological samples.

The PAR4 antibody is a potent antiviral agent that belongs to the class of antibodies. It is available in both polyclonal and monoclonal forms, with the monoclonal antibody being highly neutralizing. This antibody specifically targets the PAR4 receptor, which is involved in various cellular processes such as cyclase-activating and ketamine signaling. In the field of Life Sciences, this antibody is widely used for research purposes due to its high specificity and affinity for PAR4. It can be utilized for studying biomolecules like transferrin, low density lipoprotein (LDL), globulin, and erythropoietin. The PAR4 antibody is also commonly used in immunoassays and other analytical techniques to detect and quantify PAR4 levels. Its colloidal properties make it suitable for various applications in the biomedical field.