Anticorps primaires

Armenian Hamster monoclonal CD48 antibody (biotin)

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by inhibiting DNA-dependent RNA polymerase, which hinders transcription and replication processes essential for bacterial survival. The effectiveness of this drug has been confirmed through extensive testing using advanced techniques such as patch-clamp on human erythrocytes. Additionally, its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively impedes their growth in culture.

Rat monoclonal TER119 antibody (FITC)

CROT antibody was raised in Rabbit using Human CROT as the immunogen

The EGFR antibody is a highly specialized monoclonal antibody that targets the epidermal growth factor receptor (EGFR). This receptor plays a crucial role in cell growth and division, making it an important target for cancer treatment. The EGFR antibody works by binding to the EGFR on the surface of cancer cells, blocking its activation and preventing further cell proliferation.

The Ibuprofen antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of Ibuprofen, a nonsteroidal anti-inflammatory drug (NSAID). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The antibody specifically binds to Ibuprofen, leading to its neutralization and preventing it from exerting its anti-inflammatory effects.

The DUSP3 antibody is a multidrug antibody that targets TGF-beta, a key signaling molecule involved in various cellular processes. This antibody can be used in life sciences research to study the effects of TGF-beta on different cell types. It has been shown to neutralize the activity of TGF-beta and inhibit its downstream signaling pathways. Additionally, the DUSP3 antibody has been found to have inhibitory effects on collagen production, epidermal growth factor signaling, vasoactive intestinal peptide activity, interferon production, and TNF-alpha signaling. With its wide range of applications and potent neutralizing properties, the DUSP3 antibody is a valuable tool for researchers studying TGF-beta-related processes and diseases.

Affinity purified Rabbit polyclonal PASK antibody

USP22 antibody was raised using the middle region of USP22 corresponding to a region with amino acids PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE

Rabbit polyclonal BTF3L3 antibody

Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY

SLC5A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKT

ApoH antibody was raised in goat using human Beta-2-Glycoprotein purified from plasma as the immunogen.

Affinity purified Rabbit polyclonal CDC37L1 antibody

Rabbit polyclonal GPR19 antibody

Rabbit polyclonal SYF2 antibody

The CAMKII antibody is a powerful tool in the field of Life Sciences. It is an essential component for various experiments and research studies. This antibody can be used in conjunction with electrodes to study the effects of different factors on cellular processes. The CAMKII antibody specifically targets and binds to proteins involved in cell signaling, such as epidermal growth factor and endothelial growth factor receptors.

The Homer antibody is a growth factor that is commonly found in human serum. It is widely used in Life Sciences research and has been shown to have neutralizing effects on various nuclear factors. The antibody can be used for both in vitro and in vivo experiments, making it a versatile tool for researchers. It is available as both monoclonal and polyclonal antibodies, allowing for flexibility in experimental design. The Homer antibody has been extensively studied for its role in inhibiting the activity of mesothelin, a protein involved in cancer progression. Additionally, it has shown potential as an inhibitor of fibrinogen, collagen, and alpha-fetoprotein. Its antiviral properties make it a valuable asset in the field of virology research. With its wide range of applications and proven efficacy, the Homer antibody is a must-have for any researcher looking to advance their scientific understanding.

VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT

Purified Polyclonal COL6A2 antibody