Anticorps primaires

NMNAT1 antibody was raised using the N terminal of NMNAT1 corresponding to a region with amino acids  PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL

PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. Extensive research has shown its high activity on human erythrocytes using the patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Rabbit polyclonal PO5F1 antibody

The Lp-PLA2 monoclonal antibody is a powerful growth factor that targets specific proteins involved in the regulation of collagen and fatty acid metabolism. This antibody is designed to bind to Lp-PLA2, an enzyme responsible for the production of inflammatory mediators. By inhibiting this enzyme, the monoclonal antibody reduces inflammation and promotes healthy tissue repair.

PSENEN antibody was raised in rabbit using the C terminal of PSENEN as the immunogen

The SAMHD1 antibody is a neuroprotective globulin that is used in the field of Life Sciences. It is a monoclonal antibody that targets SAMHD1, an inhibitory factor involved in various cellular processes. This antibody has been shown to neutralize the activity of SAMHD1 and has potential applications in research and therapeutic development. The SAMHD1 antibody is highly specific and exhibits high affinity for its target. It can be used in various assays, including immunohistochemistry, Western blotting, and flow cytometry. This product is available as a monoclonal antibody with excipients to ensure stability and long shelf life. The SAMHD1 antibody is glycosylated, which enhances its binding efficiency and overall performance. With its unique properties, this antibody offers great potential for advancing scientific discoveries in the field of neuroprotection and beyond.

The XIAP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to X-linked inhibitor of apoptosis protein (XIAP), a glycoprotein that plays a crucial role in cell survival and death pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.

Rabbit polyclonal SMARCAL1 antibody

Rabbit polyclonal SIK antibody

PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen

The VTA1 antibody is a monoclonal antibody that has been developed for use in chemotherapy. It specifically targets tumor-related macrophages and works by inhibiting the production of interleukin, a protein that promotes tumor growth. The VTA1 antibody can also bind to autoantibodies and antibodies present in the body, thereby reducing their activity and preventing them from attacking healthy cells. Additionally, this antibody recognizes specific glycans on the surface of cancer cells, making it an effective tool in Life Sciences research. It has also shown antiviral properties and can be used in the development of new treatments for viral infections. The VTA1 antibody is available as both a monoclonal and polyclonal form, allowing researchers to choose the option that best suits their needs. With its ability to target antigens extracellularly and withstand high-flux irradiation, this antibody is a valuable asset in the field of cancer research and treatment.

CSF2RA antibody was raised in Rabbit using Human CSF2RA as the immunogen

Mouse monoclonal gp64 antibody (allophycocyanin)

Affinity purified Chicken polyclonal NET1 antibody