Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.722 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.591 produits)
- Anticorps du métabolisme(291 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.771 produits)
- Tags & Marqueurs cellulaires(34 produits)
75602 produits trouvés pour "Anticorps primaires"
STIP1 antibody
STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
KLHL31 antibody
KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
Degré de pureté :Min. 95%Syntrophin Beta 1 antibody
Syntrophin Beta 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELDegré de pureté :Min. 95%ULBP1 antibody
The ULBP1 antibody is a monoclonal antibody that specifically targets ULBP1, a protein expressed in various tissues including adipose tissue. This antibody is widely used in life sciences research to study the role of ULBP1 in different biological processes. It can be used for applications such as immunohistochemistry, western blotting, and flow cytometry. The ULBP1 antibody has been shown to effectively detect ULBP1 expression in cell lines like MCF-7 and can be used to investigate its interaction with other proteins such as the adiponectin receptor. Additionally, this antibody can be utilized as a potential therapeutic tool or as a research reagent for studying growth factors and their inhibitors. With its high specificity and sensitivity, the ULBP1 antibody is an invaluable tool for researchers in the field of life sciences.
