Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
IL3 antibody
IL3 antibody is a polyclonal antibody that specifically targets and binds to IL3, a cytokine involved in the regulation of hematopoiesis. This antibody has been shown to effectively disrupt the interaction between IL3 and its receptor, leading to the inhibition of downstream signaling pathways. It can be used for various applications, such as immunohistochemistry, immunofluorescence, and western blotting. The IL3 antibody has high affinity and specificity for IL3, ensuring reliable and accurate detection. Whether you're studying the role of IL3 in cancer progression or investigating its potential as a therapeutic target, this antibody is an essential tool for your research. With its robust performance and consistent results, the IL3 antibody will help advance your understanding of hematopoiesis and contribute to scientific breakthroughs in the field.
PARD6B antibody
PARD6B antibody was raised using a synthetic peptide corresponding to a region with amino acids MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHV
CAD antibody
CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE
NR4A1 antibody
The NR4A1 antibody is a monoclonal antibody that targets the cholinergic receptor NR4A1. It has been extensively studied in the field of Life Sciences and has shown promising results in various assays. This antibody has been found to be effective in inhibiting the activity of NR4A1, which plays a crucial role in thrombocytopenia and other related conditions. The NR4A1 antibody works by binding to the receptor and blocking its function, leading to a decrease in platelet production. In addition, this antibody has also been used in research studies involving histidine and epidermal growth factor, further highlighting its versatility. With its cytotoxic properties and ability to inhibit choline acetyltransferase, the NR4A1 antibody holds great potential for therapeutic applications. It is available as both a monoclonal and polyclonal antibody, making it suitable for various research needs.
CYP2D6 antibody
The CYP2D6 antibody is a polyclonal antibody that specifically targets the CYP2D6 enzyme. This enzyme is responsible for metabolizing a wide range of drugs, including bufuralol and interferon. The CYP2D6 antibody recognizes immunodominant epitopes on the enzyme and can be used in various research applications.
CSA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
