Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
CD137L antibody
CD137L antibody was raised in rabbit using highly pure recombinant human 4-1BBL as the immunogen.
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Degré de pureté :Min. 95%Desmoplakin 1+2 antibody
Desmoplakin 1+2 antibody was raised in mouse using C-terminal polypeptide of recombinant human desmoplakin as the immunogen.
Goat anti Rabbit IgG (H + L) (HRP)
Goat anti-rabbit IgG (H+L) (HRP) was raised in goat using rabbit IgG, whole molecule as the immunogen.Degré de pureté :Min. 95%Human Serum Albumin antibody (biotin)
Human serum albumin antibody (HRP) was raised in rabbit using human serum albumin as the immunogen.
Synaptobrevin 2 antibody
Synaptobrevin 2 antibody was raised in mouse using recombinant human Synaptobrevin 2 (1-89aa) purified from E. coli as the immunogen.HTR1A antibody
HTR1A antibody was raised in rabbit using the N terminal of HTR1A as the immunogen
Degré de pureté :Min. 95%UCP2 antibody
UCP2 antibody was raised in rabbit using a 14 amino acid peptide from mouse UCP2 as the immunogen.Degré de pureté :Min. 95%SIRT5 antibody
SIRT5 antibody was raised using the middle region of SIRT5 corresponding to a region with amino acids PICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLD
CD209 antibody
The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.
Degré de pureté :Min. 95%Transferrin antibody
Transferrin antibody was raised in rabbit using rat transferrin as the immunogen.
Degré de pureté :Min. 95%Goat anti Rat IgG (Fab'2) (rhodamine)
Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.
Degré de pureté :Min. 95%Goat anti Rat IgG (H + L) (Fab'2) (rhodamine)
Goat anti-rat IgG (H + L) (Fab'2) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.
Degré de pureté :Min. 95%
