Anticorps primaires

SYTL1 antibody was raised in rabbit using the N terminal of SYTL1 as the immunogen

SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG

The Oxytocin antibody is a highly specialized monoclonal antibody that has been activated and designed to target and inhibit the effects of oxytocin. This antibody specifically binds to histidine residues in the oxytocin molecule, blocking its activity and preventing it from binding to its receptors.

PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK

Rabbit polyclonal GABRB3 antibody (Ser408/409)

Apelin Receptor antibody is a monoclonal antibody that specifically targets the apelin receptor, a G-protein coupled receptor involved in various physiological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to alpha-fetoprotein, acidic androgen protein, autoantibodies, lysozyme, leukemia inhibitory factor, glycosylation, arginase, and other related factors. The Apelin Receptor antibody is widely used as a research tool for studying the role of apelin signaling pathways and its potential therapeutic applications. With its high specificity and inhibitory effects on apelin receptor activation, this antibody offers valuable insights into understanding the complex mechanisms underlying various biological processes.

GNL3L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN

Affinity purified Rabbit polyclonal NDUFA1 antibody

AGXT2L1 antibody was raised using the middle region of AGXT2L1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT

APLF antibody was raised in Rabbit using Human APLF as the immunogen

Rabbit polyclonal PPPDE1 antibody

SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

CHRNB3 antibody was raised in rabbit using the middle region of CHRNB3 as the immunogen

Affinity purified Rabbit polyclonal PEX6 antibody

HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS

Affinity purified Rabbit polyclonal ZFP 574 antibody

Rabbit polyclonal IFNG antibody (biotin)

Rabbit polyclonal OR4F4 antibody

Rat monoclonal CD4 antibody (biotin); mouse target; IgG2b kappa; clone GK1.5

ARHGAP10 antibody was raised in Rabbit using Human ARHGAP10 as the immunogen