Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
GSTP1 antibody
GSTP1 antibody was raised in Mouse using a purified recombinant fragment of human GSTP1 expressed in E. coli as the immunogen.Cytokeratin 20 antibody
Cytokeratin 20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.
PCYT2 antibody
PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
Rabbit anti Bovine IgG (biotin)
Rabbit anti-bovine IgG (biotin) was raised in rabbit using bovine IgG F(c) fragment as the immunogen.Degré de pureté :Min. 95%PRKAR1A antibody
PRKAR1A antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets PRKAR1A, a human protein involved in various biochemical processes. This antibody can be used for research purposes, such as studying the role of PRKAR1A in cellular functions and signaling pathways.
Myc antibody
The Myc antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor interleukin-6 (IL-6). IL-6 is known to play a crucial role in various biological processes, including cell proliferation and cytotoxicity. By specifically binding to IL-6, the Myc antibody effectively inhibits its activity, preventing excessive cell growth and promoting a balanced cellular environment.
Phosphothreonine antibody (biotin)
Phosphothreonine antibody (biotin) was raised in rabbit using phosphothreonine-KLH and phosvitin mixture as the immunogen.
HAVCR1 antibody
HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRDegré de pureté :Min. 95%MEF2C antibody
The MEF2C antibody is a cytotoxic monoclonal antibody that targets the MEF2C protein. It has been shown to have multidrug resistance and can inhibit the production of interleukin-6 and chemokines. This antibody specifically binds to the p38 mitogen-activated protein and glycoprotein receptors, leading to cell death in cancer cells. Additionally, it has been found to have an inhibitory effect on steroid and fibronectin synthesis, which are important for tumor growth and metastasis. The MEF2C antibody is widely used in life sciences research and shows promise as a potential therapeutic agent in cancer treatment, particularly in combination with other monoclonal antibodies like trastuzumab.HSV2 antibody (HRP)
HSV2 antibody (HRP) was raised in sheep using HSV type 2, strain G as the immunogen.
