Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
CD55 antibody
The CD55 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize glutamate, a key molecule involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications, particularly in the treatment of HER2-positive cancers.
PPIE antibody
PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
ZC3H12A antibody
The ZC3H12A antibody is a polyclonal antibody that is used in life sciences research. It has been shown to interact with various proteins and molecules, including alpha-fetoprotein, macrophage colony-stimulating factor, interferon, phosphatase, acidic glutamate, and vasoactive intestinal peptide. This antibody is commonly used in studies related to immune response and cell signaling pathways. It specifically targets the ZC3H12A protein, which is known to play a role in regulating inflammatory responses. The ZC3H12A antibody can be used for various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it a valuable tool for researchers studying immune system function and related diseases.
FABP antibody
The FABP antibody is a growth factor that targets adipose tissue. It is a monoclonal antibody specifically designed to bind to fatty acid binding proteins (FABPs). FABPs play a crucial role in the transport and metabolism of fatty acids within cells. By targeting FABPs, this antibody can modulate their activity and potentially impact various cellular processes.ALOX15B antibody
ALOX15B antibody was raised using the N terminal of ALOX15B corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE
CD122 antibody (FITC)
CD122 antibody (FITC) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/mol
