Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
CD25 antibody (PE-CY7)
CD25 antibody (PE-CY7) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molTMPRSS4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp technique, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture. With its unique mechanisms of action and potent properties, the 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is
Goat anti Human IgG (Fab'2) (HRP)
Goat anti-human IgG (Fab'2) (HRP) was raised in goat using human IgG F(ab’)2 fragment as the immunogen.Degré de pureté :Min. 95%CCL5 antibody
The CCL5 antibody is a highly specialized polyclonal antibody used in life sciences research. It is designed to specifically target and neutralize the CCL5 protein, a growth factor involved in angiogenesis and inflammation. This antibody can be used in various experimental techniques, such as immunohistochemistry or Western blotting, to study the role of CCL5 in different biological processes. It has been extensively tested and validated for its specificity and effectiveness in binding to the target molecule. Researchers can rely on this high-quality antibody to accurately detect and quantify CCL5 levels in samples, providing valuable insights into its function and potential therapeutic applications.
LOC642097 antibody
LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL
MPT64 antibody
The MPT64 antibody is a highly specific monoclonal antibody that acts as an inhibitor against certain viruses and antibodies. It is commonly used in the field of Life Sciences for various applications. This antibody has been shown to have a strong affinity for interferon-gamma (IFN-gamma), a potent growth factor involved in immune response regulation. Additionally, it has the ability to bind to nuclear proteins and inhibit polymerase chain reactions (PCR). The MPT64 antibody can also be used to detect virus surface antigens in human serum samples, making it a valuable tool in diagnostic testing. With its electrode-activated properties, this antibody ensures accurate and reliable results in research and clinical settings.
