Anticorps primaires

Affinity purified Rabbit polyclonal Dipeptidyl peptidase 3 antibody

MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE

The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.

Affinity purified Rabbit polyclonal ZNF313 antibody

The MAP2 antibody is a growth factor antagonist that binds to specific proteins in order to inhibit their activity. It is a monoclonal antibody, meaning it is produced from a single clone of cells and is highly specific in its binding properties. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

Na+ Ca2+ exchanger antibody (cardiac) was raised in rabbit using canine cardiac sarcolemma Na+/Ca2+ exchanger as the immunogen.

The SKP2 antibody is a monoclonal antibody that targets the growth factor SKP2. It acts as a kinase inhibitor, inhibiting the activity of SKP2 and preventing its role in cell proliferation. This antibody has been shown to have inhibitory properties against various growth factors, including epidermal growth factor and interferon. Additionally, it has been found to modulate the levels of creatine kinase and β-catenin, which are important proteins involved in cell signaling pathways. The SKP2 antibody can be used for research purposes, such as studying the cytotoxic effects of SKP2 inhibition or investigating its role in collagen synthesis.

CCDC158 antibody was raised in Rabbit using Human CCDC158 as the immunogen

Affinity purified Rabbit polyclonal LIM kinase 2 antibody

Rabbit polyclonal USP49 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp techniques, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

HMG20B antibody was raised in Rabbit using Human HMG20B as the immunogen

Cytokeratin 10 antibody is a highly specialized monoclonal antibody that targets the glycoprotein Cytokeratin 10. It is used for its neutralizing properties in various applications such as immunohistochemistry and Western blotting. This antibody has been extensively tested and validated to ensure its high specificity and sensitivity. It can effectively detect Cytokeratin 10 expression in adipose tissues, human serum, and other biological samples. Additionally, it has been shown to have cytotoxic effects on certain cancer cells when used in combination with active agents like Sn-38. With its exceptional binding affinity and ability to inhibit the activity of Cytokeratin 10, this antibody is a valuable tool for researchers studying autoimmune diseases, cancer biology, and interferon signaling pathways. Whether you are conducting basic research or developing diagnostic assays, this Cytokeratin 10 antibody will provide reliable and accurate results.

IFN gamma antibody is a highly specific antibody that targets interferon gamma, a key cytokine involved in immune response regulation. This antibody can be used in various research applications, including immunohistochemistry, Western blotting, and ELISA. It specifically recognizes the carbonyl group of IFN gamma and has been extensively validated for its high affinity and specificity. It can effectively neutralize the activity of IFN gamma in vitro and in vivo, making it a valuable tool for studying the role of this cytokine in various biological processes. Whether you are investigating immune responses, studying growth factors, or exploring the effects of IFN gamma on different cell types, this antibody is an excellent choice for your research needs. Trust its reliable performance to provide accurate and reproducible results every time.

Affinity purified Rabbit polyclonal Annexin A6 antibody

Affinity purified Rabbit polyclonal SLC22A6 antibody

Affinity purified Mouse polyclonal HOXA6 antibody