Anticorps primaires

The AQP3 antibody is a spectrometric monoclonal antibody that is used in Life Sciences research. It specifically targets the aquaporin-3 (AQP3) protein, which plays a crucial role in water and glycerol transport across cell membranes. This antibody has been extensively studied and validated for its ability to detect AQP3 in various samples, including human serum.

Affinity purified Rabbit polyclonal ALOX5 antibody

Protein C antibody (HRP) was raised in sheep using human Protein C purified from plasma as the immunogen.

Affinity purified Rabbit polyclonal Calpain 1 antibody

DBH antibody was raised in Rabbit using Human DBH as the immunogen

CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL

The SIGLEC9 antibody is a polyclonal antibody that specifically targets SIGLEC9, a glycoprotein that plays a crucial role in various biological processes. This antibody is produced using glycine and disulfide bond technology, resulting in high-quality antibodies with excellent specificity and sensitivity. It can be used in various applications in the field of life sciences, such as immunohistochemistry, flow cytometry, and Western blotting.

Rabbit polyclonal GRIN2A antibody (N-terminus)

CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP

Affinity purified Rabbit polyclonal MAP3K2 antibody

The CEA antibody is a monoclonal antibody that targets the carcinoembryonic antigen (CEA), a protein that is overexpressed in certain types of cancer cells. This antibody specifically binds to CEA and can be used for various applications in the field of Life Sciences. It has been widely used in research studies to detect CEA expression in tumor tissues and monitor its levels in patient samples.

Rabbit polyclonal Rhombotin 1 antibody

The MMP2 antibody is a highly specialized polyclonal antibody that targets the matrix metalloproteinase 2 (MMP2) protein. This antibody is widely used in life sciences research to study the role of MMP2 in various biological processes. MMP2 is a key enzyme involved in the degradation of extracellular matrix components, and its dysregulation has been implicated in several diseases, including cancer, cardiovascular diseases, and inflammatory disorders.

The RAD51A antibody is a highly specialized polyclonal antibody that is commonly used in life sciences research. It is also available as a monoclonal antibody for more specific applications. This antibody plays a crucial role in DNA repair and recombination processes by binding to the RAD51 protein, which is involved in homologous recombination. The RAD51A antibody can be used in various techniques, such as immunofluorescence, immunohistochemistry, and western blotting, to study the expression and localization of RAD51A in different cell types and tissues. It is often conjugated with colloidal gold or fluorescent dyes like fluorescein isothiocyanate (FITC) for easy detection. The RAD51A antibody has high affinity and specificity for its target antigen, allowing for accurate quantitation and neutralizing activity against the RAD51 protein. Researchers rely on this antibody to gain insights into DNA repair mechanisms, cancer biology, and other areas of scientific interest.

CIDEA antibody was raised in Rabbit using Human CIDEA as the immunogen

The MC5R antibody is a highly specialized monoclonal antibody that binds to the MC5 receptor, a specific type of receptor found in various cells throughout the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.

RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE

The KLK7 antibody is a highly potent and specific monoclonal antibody that targets the KLK7 antigen. It has been widely used in Life Sciences research for its ability to detect and immobilize KLK7 in various applications. This antibody binds to KLK7 with high affinity, allowing for accurate and reliable detection of this protein. Additionally, the KLK7 antibody has been shown to have minimal cross-reactivity with other proteins, ensuring precise and specific results. It is commonly used in studies involving actin filaments, atypical hemolytic disorders, and nuclear localization of proteins. The KLK7 antibody is available in both purified and conjugated forms, making it versatile for a wide range of experimental needs. With its exceptional sensitivity and specificity, this antibody is an essential tool for researchers in the field of Life Sciences.

NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV

The CD44 antibody is a powerful tool used in Life Sciences research. It belongs to the category of anti-ICOS antibodies and is widely used in various applications. This antibody specifically targets CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion, migration, and signaling.