Anticorps primaires

NDUFA9 antibody was raised in Rabbit using Human NDUFA9 as the immunogen

SLC10A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP

Affinity purified Rabbit polyclonal C1orf165 antibody

Mouse PMN antibody (FITC) was raised in rabbit using mouse PMNs as the immunogen.

Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

The hCG beta antibody is a protein that belongs to the Life Sciences category. It functions by binding to the nuclear factor kappa-light-chain-enhancer in order to regulate gene expression. This antibody is commonly used in research and diagnostic applications, particularly in the field of reproductive health. It has been shown to interact with various proteins, including mitogen-activated protein and β-catenin, which are involved in cellular signaling pathways. Additionally, this antibody has been found to have an inhibitory effect on the activity of p38 mitogen-activated protein phosphatase and caspase-9, both of which play important roles in cell growth and apoptosis. The hCG beta antibody is available as a monoclonal antibody, making it highly specific and reliable for use in experiments and assays requiring precise detection and analysis of target molecules.

CD117 antibody (PE) was raised in rat using murine CD117/c-Kit as the immunogen.

KCNIP3 antibody was raised in Rabbit using Human KCNIP3 as the immunogen

TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI

NHP2 antibody was raised in Rabbit using Human NHP2 as the immunogen

Rabbit polyclonal PIGO antibody

BCL2A1 antibody was raised in rabbit using the C terminal of BCL2A1 as the immunogen

Affinity purified Rabbit polyclonal Galanin Receptor 2 antibody