Anticorps primaires

NSUN4 antibody was raised using the N terminal of NSUN4 corresponding to a region with amino acids QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSP

FOXE3 antibody was raised in Rabbit using Human FOXE3 as the immunogen

PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP

The p27 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets c-myc, antiphospholipid antibodies, autoantibodies, fibrinogen, superoxide, antibodies, tyrosine, ribosomal binding, alpha-synuclein, Polyclonal Antibodies, collagen, and anticoagulant. This antibody plays a crucial role in various research applications such as immunohistochemistry (IHC), western blotting (WB), and enzyme-linked immunosorbent assay (ELISA).

EEF1G antibody was raised using the N terminal of EEF1G corresponding to a region with amino acids AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF

Mouse monoclonal ZFAND2B antibody

Affinity purified Rabbit polyclonal RBP2 antibody

The SDC3 antibody is a highly specialized antibody that targets the nuclear receptor SDC3. It is available in both polyclonal and monoclonal forms, offering versatility for various research applications in the field of Life Sciences. This antibody specifically recognizes SDC3 and can be used to study its role in different biological processes.

Affinity purified Rabbit polyclonal TMLHE antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing the growth of bacteria. Its efficacy has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

NAMPT antibody was raised in Rabbit using Human NAMPT as the immunogen

Biotin Conjugated Chicken anti-Protein A (staphylococcal) Antibody

Please enquire for more information about Cryptococcus neoformans antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about anti-Mouse C3 Antibody (FITC) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Cryptococcus neoformans Monoclonal antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about anti-C-Myc Antibody (HRP) including the price, delivery time and more detailed product information at the technical inquiry form on this page

NAB1 antibody was raised in mouse using recombinant Human Ngfi-A Binding Protein 1 (Egr1 Binding Protein 1)

Rabbit polyclonal TMF1 antibody

Rabbit polyclonal UBTD2 antibody